Charybdotoxin TFA
Based on 1 Customer Validation
Charybdotoxin TFA, a 37-amino acid peptide, is a K+ channel blocker.
For research use only. We do not sell to patients.
- Purity: 96.83%
- Formula: C176H277N57O55S7.xC2HF3O2
- Molecular Weight:4295.89 (free acid)
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Charybdotoxin represents a remarkable tool for studying K+ channels[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4295.89 (free acid)
-
Formula C176H277N57O55S7.xC2HF3O2
-
Color White to off-white
-
Sequence
{Glp}-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35)
-
Sequence Shortening
{Glp}-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Solvent & Solubility
H2O : ≥ 100 mg/mL
* "≥" means soluble, but saturation unknown.
Purity & Documentation
-
Data Sheet (270 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Charybdotoxin TFA Related Classifications
HY-P0191A Related Classifications
Powered by Bioz