Pezadeftide
Pezadeftide (HXP124) is a naturally derived plant defensin peptide molecule with antifungal activity. Pezadeftide binds to fungal cell wall chitin and β-glucan, enters fungal cells via endocytosis; induces mitochondrial membrane hyperpolarization, promotes ROS generation, further triggers vacuole fusion, alters plasma membrane permeability, and ultimately causes fungal cell death. Pezadeftide exhibits inhibitory effects against various skin and nail pathogenic fungi. Pezadeftide can be used in research related to fungal infections.
Para uso exclusivo en investigación. No vendemos a pacientes.
- No. CAS: 1907724-92-8
- Fòrmula: C234H372N70O66S8
- Peso molecular:5478.41
-
Almacenamiento:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
- Protocolo
- Pureza y Documentación
- Referencias
-
Help & FAQs
Actividad biológica
Descripciòn
In Vitro
Pezadeftide selects resistant S. cerevisiae deletion strains enriched in mitochondrial respiration and sphingolipid biosynthesis, among which F1-F0 ATP synthase mutants exhibit higher tolerance[2].
Pezadeftide permeabilizes the S. cerevisiae plasma membrane in a concentration-dependent manner, induces ROS, and hyperpolarizes the mitochondrial membrane potential in S. cerevisiae BY4741[2].
Pezadeftide induces ROS at 3-7 min and triggers vacuolar fusion at 14-16 min[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
No. CAS 1907724-92-8
-
Peso molecular 5478.41
-
Fòrmula C234H372N70O66S8
-
Synonyms
HXP124
-
Sequence
Ala-Lys-Val-Cys-Thr-Lys-Pro-Ser-Lys-Phe-Phe-Lys-Gly-Leu-Cys-Gly-Thr-Asp-Gly-Ala-Cys-Thr-Thr-Ala-Cys-Arg-Lys-Glu-Gly-Leu-His-Ser-Gly-Tyr-Cys-Gln-Leu-Lys-Gly-Phe-Leu-Asn-Ser-Val-Cys-Val-Cys-Arg-Lys-His-Cys (Disulfide bridge:Cys4-Cys51,Cys15-Cys35,Cys21-Cys45,Cys25-Cys47)
-
Sequence Shortening
AKVCTKPSKFFKGLCGTDGACTTACRKEGLHSGYCQLKGFLNSVCVCRKHC (Disulfide bridge:Cys4-Cys51,Cys15-Cys35,Cys21-Cys45,Cys25-Cys47)
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureza y Documentación
Referencias
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Pezadeftide Related Classifications
HY-P3384 Related Classifications
Powered by Bioz