Hainantoxin-III
Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively.
For research use only. We do not sell to patients.
- CAS No.: 1809149-40-3
- Formula: C154H228N44O45S6
- Molecular Weight:3608.12
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
IC50 & Target
|
Nav1.2 |
Nav1.3 |
Nav1.7 |
Chemical Information
-
CAS No. 1809149-40-3
-
Molecular Weight 3608.12
-
Formula C154H228N44O45S6
-
Sequence
Gly-Cys-Lys-Gly-Phe-Gly-Asp-Ser-Cys-Thr-Pro-Gly-Lys-Asn-Glu-Cys-Cys-Pro-Asn-Tyr-Ala-Cys-Ser-Ser-Lys-His-Lys-Trp-Cys-Lys-Val-Tyr-Leu-NH2 (Disulfide bonds: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
-
Sequence Shortening
GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL-NH2 (Disulfide bonds: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Yucheng Xiao, et al. Inhibition of neuronal tetrodotoxin-sensitive Na+ channels by two spider toxins: hainantoxin-III and hainantoxin-IV. Eur J Pharmacol. 2003 Sep 5;477(1):1-7. [Content Brief]
[2]. Yunxiao Zhang, et al. Engineering of highly potent and selective HNTX-III mutant against hNav1.7 sodium channel for treatment of pain. J Biol Chem. 2021 Jan-Jun:296:100326. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)