Hainantoxin-III
Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively.
For research use only. We do not sell to patients.
- CAS No.: 1809149-40-3
- Formula: C154H228N44O45S6
- Molecular Weight:3608.12
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Protocols
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
IC50 & Target
|
Nav1.2 |
Nav1.3 |
Nav1.7 |
Chemical Information
-
CAS No. 1809149-40-3
-
Molecular Weight 3608.12
-
Formula C154H228N44O45S6
-
Sequence
Gly-Cys-Lys-Gly-Phe-Gly-Asp-Ser-Cys-Thr-Pro-Gly-Lys-Asn-Glu-Cys-Cys-Pro-Asn-Tyr-Ala-Cys-Ser-Ser-Lys-His-Lys-Trp-Cys-Lys-Val-Tyr-Leu-NH2 (Disulfide bonds: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
-
Sequence Shortening
GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL-NH2 (Disulfide bonds: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocols
-
Cell Cytotoxicity Assay
Cytotoxicity assays are usually based on the assessment of cell membrane damage, which can also be indirectly detected by measuring cell viability. Detection methods include MTT assay, CKK-8 assay, LDH assay and ATP assay, etc.
-
Primary Dorsal Root Ganglion Sensory Neuron Culture
Primary dorsal root ganglion sensory neuron culture isolates DRG neuronal somata from rodent or human ganglia, dissociates tissue enzymatically and mechanically, and maintains post-mitotic sensory neurons in vitro for readouts such as neurite outgrowth, immunocytochemical marker expression, calcium imaging, electrophysiology, RNA/protein analysis, or neuropeptide release assays. The method reflects peripheral sensory neuron biology because DRG neurons are primary sensory neurons whose cell bodies reside in dorsal root ganglia and whose cultured dissociated cells can retain neuronal morphology, sensory-neuron marker expression, and stimulus-responsive properties depending on the downstream assay.
Purity & Documentation
References
[1]. Yucheng Xiao, et al. Inhibition of neuronal tetrodotoxin-sensitive Na+ channels by two spider toxins: hainantoxin-III and hainantoxin-IV. Eur J Pharmacol. 2003 Sep 5;477(1):1-7. [Content Brief]
[2]. Yunxiao Zhang, et al. Engineering of highly potent and selective HNTX-III mutant against hNav1.7 sodium channel for treatment of pain. J Biol Chem. 2021 Jan-Jun:296:100326. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Hainantoxin-III Related Classifications
HY-P5180 Related Classifications
Powered by Bioz