Aviptadil
Based on 2 publication(s) in Google Scholar
Aviptadil is an analog vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. Aviptadil induces pulmonary vasodilation and inhibits vascular SMCs proliferation, platelet aggregation. Aviptadil can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH) and SARS-CoV-2 caused respiratory failure, et al.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- Purity: 99.95%
- CAS No.: 40077-57-4
- 화학식: C147H238N44O42S
- 분자량:3325.80
-
보관:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) Aviptadil
More
Biological Activity
Aviptadil (150 μg/kg/d; Intraperitoneal pump; 2.5 μl/h; 4 weeks) can eliminate bronchial hyperreactivity (BHR) in Sprague-Dawley rats, with a characteristic of bronchiectasis[3].
Aviptadil (0.1, 3 μg/kg; Intravenous injection (i.v.)) can improve reperfusion injury in living rat lung transplantation models[5].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Sprague Dawley rats
-
Dosage:Bosentan (HY-A0013 ) 300 mg/kg, Aviptadil 500 μg/kg
-
Administration:Bosentan (HY-A0013 ) Oral gavage (p.o); Aviptadil Intraperitoneal injection (i.p)
-
Result:Starting on day 21, the rats treated with Bosentan or Aviptadil alone had a 29% reduction in mortality (P< 0.0001). No death was observed in the rats during the same time period.
Chemical Information
-
CAS No. 40077-57-4
-
Appearance Solid
-
분자량 3325.80
-
화학식 C147H238N44O42S
-
Color White to off-white
-
Synonyms
Vasoactive Intestinal Peptide (human, rat, mouse, rabbit, canine, porcine)
-
Sequence
His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
-
Sequence Shortening
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Nucleic Acids Res
COVID19 Drug Repository: text-mining the literature in search of putative COVID19 therapeutics. [Abstract]2021 Jan 8;49(D1):D1113-D1121. PMID: 33166390 -
용액&용해도
H2O : 100 mg/mL (30.07 mM; Need ultrasonic)
DMSO : 50 mg/mL (15.03 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
순도&문서
-
Data Sheet (282 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Intravenous Aviptadil for Critical COVID-19 With Respiratory Failure (COVID-AIV)
[2]. Jian Hu, et al. Novel Targets of Drug Treatment for Pulmonary Hypertension. Am J Cardiovasc Drugs [Content Brief]
[3]. Hamidi SA, et al. VIP and endothelin receptor antagonist: an effective combination against experimental pulmonary arterial hypertension. Respir Res. 2011;12(1):141. Published 2011 Oct 26. [Content Brief]
[5]. Nagahiro I, et al. Vasoactive intestinal peptide ameliorates reperfusion injury in rat lung transplantation. J Heart Lung Transplant. 1998;17(6):617-621. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO / H2O | 1 mM | 0.3007 mL | 1.5034 mL | 3.0068 mL | 7.5170 mL |
| 5 mM | 0.0601 mL | 0.3007 mL | 0.6014 mL | 1.5034 mL | |
| 10 mM | 0.0301 mL | 0.1503 mL | 0.3007 mL | 0.7517 mL | |
| 15 mM | 0.0200 mL | 0.1002 mL | 0.2005 mL | 0.5011 mL | |
| H2O | 20 mM | 0.0150 mL | 0.0752 mL | 0.1503 mL | 0.3758 mL |
| 25 mM | 0.0120 mL | 0.0601 mL | 0.1203 mL | 0.3007 mL | |
| 30 mM | 0.0100 mL | 0.0501 mL | 0.1002 mL | 0.2506 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.