Nocistatin(human) TFA
Nocistatin (human) TFA blocks nociceptin-induced allodynia and hyperalgesia, and attenuates pain evoked by prostaglandin E2.
For research use only. We do not sell to patients.
- Formula: C149H238N42O53S3.C2HF3O2
- Molecular Weight:3675.95
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Nocistatin (5.0 nmol) significantly improves the nociception (5.0 nmol)-induced impairment of learning and memory without changing motor activity or response to electric shocks[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Molecular Weight 3675.95
-
Formula C149H238N42O53S3.C2HF3O2
-
Sequence
Met-Pro-Arg-Val-Arg-Ser-Leu-Phe-Gln-Glu-Gln-Glu-Glu-Pro-Glu-Pro-Gly-Met-Glu-Glu-Ala-Gly-Glu-Met-Glu-Gln-Lys-Gln-Leu-Gln
-
Sequence Shortening
MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. E Okuda-Ashitaka, et al. Nocistatin, a peptide that blocks nociceptin action in pain transmission. Nature. 1998 Mar 19;392(6673):286-9. [Content Brief]
[2]. M Hiramatsu, et al. Effects of nocistatin on nociceptin-induced impairment of learning and memory in mice. Eur J Pharmacol. 1999 Feb 19;367(2-3):151-5. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)