1. Peptides
  2. Nocistatin(human)

Nocistatin(human) 

Cat. No.: HY-P1020
Handling Instructions

Nocistatin (human) blocks nociceptin-induced allodynia and hyperalgesia, and attenuates pain evoked by prostaglandin E2.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Nocistatin(human) Chemical Structure

Nocistatin(human) Chemical Structure

CAS No. : 212609-11-5

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Other Forms of Nocistatin(human):

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Nocistatin (human) blocks nociceptin-induced allodynia and hyperalgesia, and attenuates pain evoked by prostaglandin E2[1].

In Vitro

Nocistatin (5.0 nmol) significantly improves the nociception (5.0 nmol)-induced impairment of learning and memory without changing motor activity or response to electric shocks[2].

Molecular Weight

3561.93

Formula

C₁₄₉H₂₃₈N₄₂O₅₃S₃

CAS No.

212609-11-5

Sequence

Met-Pro-Arg-Val-Arg-Ser-Leu-Phe-Gln-Glu-Gln-Glu-Glu-Pro-Glu-Pro-Gly-Met-Glu-Glu-Ala-Gly-Glu-Met-Glu-Gln-Lys-Gln-Leu-Gln

Sequence Shortening

MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Nocistatin(human)OthersInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Nocistatin(human)
Cat. No.:
HY-P1020
Quantity:
MCE Japan Authorized Agent: