Pepinh-TRIF TFA
Based on 11 publication(s) in Google Scholar
Pepinh-TRIF (TFA) is a 30 aa peptide that blocks TIR-domain-containing adapter-inducing interferon-β (TRIF) signaling by interfering with TLR-TRIF interaction.
For research use only. We do not sell to patients.
- Purity : 99.79%
- Formula: C177H273N55O40S2.xC2HF3O2
- Molecular Weight:3875.54 (free base)
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications Citing Use of MedChemExpress (MCE) Pepinh-TRIF TFA
More- Immunity. 2026 Aug 6:S1074-7613(26)00306-7.
- Adv Funct Mater. 2025 Aug 3.
- Adv Sci (Weinh). 2025 Oct 27:e13775. [Abstract]
- Antiviral Res. 2024 Feb:222:105797. [Abstract]
- PeerJ. 2024 Jan 2:12:e16716. [Abstract]
- Vet Microbiol. 2026 Jul:318:111032. [Abstract]
- Vet Microbiol. 2023 Oct:285:109867. [Abstract]
- Curr Eye Res. 2025 Feb;50(2):203-212. [Abstract]
- bioRxiv. 2025 Sep 9:2025.09.08.674928. [Abstract]
- Res Sq. 2025 Jul 17.
- bioRxiv. 2023 Apr 25.
-
RT-PCR
-
WB
-
Cell Proliferation/Viability Assay
-
RT-PCR
-
WB
Biological Activity
Description
IC50 & Target
|
TLRs |
In Vitro
Pepinh-TRIF (40 μM, 6 hours) blocks the expression and production of IL-33 stimulated by polyI:C or flagellin, and also greatly suppresses the stimulated IκB-α phosphorylation and degradation in HCECs[1].
Pepinh-TRIF (40 μM, 6 hours) suppresses NF-κB activation with p65 protein nuclear translocation [1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. .
-
Cell Line:HCECs
-
Concentration:40 μM
-
Incubation Time:6 hours
-
Result:Blocked NF-κB activation with p65 nuclear translocation.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3875.54 (free base)
-
Formula C177H273N55O40S2.xC2HF3O2
-
Color White to off-white
-
Sequence
Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Phe-Cys-Glu-Glu-Phe-Gln-Val-Pro-Gly-Arg-Gly-Glu-Leu-His-NH2
-
Sequence Shortening
RQIKIWFQNRRMKWKKFCEEFQVPGRGELH-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications (11)
-
Journal Impact Factor
-
Most Recent
-
-
Pepinh-TRIF TFA purchased from MedChemExpress. Usage Cited in: Adv Funct Mater. 2025 Aug 3.
Gene expression of IFN-β, TNF-α, IL-6, and CCL2 in RAW 264.7 cells incubated with 100 µg/mL M-BSA@PSiNPs or 100 µg/mL M-BSA for 6 h in the presence of 40 µmol/L TJ-M or 20 µmol/L TFA (Pepinh-TRIF TFA), respectively.
-
Adv Sci (Weinh)
VDLIN: A Deep Learning-Based Platform for Methylcobalamin-Inspired Immunomodulatory Compound Screening. [Abstract]2025 Oct 27:e13775. PMID: 41144841 -
Antiviral Res
PZR suppresses innate immune response to RNA viral infection by inhibiting MAVS activation in interferon signaling mediated by RIG-I and MDA5. [Abstract]2024 Feb:222:105797. PMID: 38185222 -
PeerJ
The role of TRIF protein in regulating the proliferation and antigen presentation ability of myeloid dendritic cells through the ERK1/2 signaling pathway in chronic low-grade inflammation of intestinal mucosa mediated by flagellin-TLR5 complex signal. [Abstract]2024 Jan 2:12:e16716. PMID: 38188180
Pepinh-TRIF TFA purchased from MedChemExpress. Usage Cited in: PeerJ. 2024 Jan 2:12:e16716. [Abstract]
Cells were treated with the TRIF-specific inhibitor Pepinh-TRIF TFA (40 μM). Western blotting was used to detect the expression of TRIF and p-ERK1/2 proteins in the cells of each group.
Pepinh-TRIF TFA purchased from MedChemExpress. Usage Cited in: PeerJ. 2024 Jan 2:12:e16716. [Abstract]
Intervention was performed using the TRIF-specific inhibitor Pepinh-TRIF TFA (40 μM). Cell proliferation in each group was assessed using the CCK-8 assay.
-
Vet Microbiol
TRIF signaling is essential for the activation of dendritic cells during porcine rotavirus infection. [Abstract]2026 Jul:318:111032. PMID: 42054951 -
Vet Microbiol
M1 polarization of chicken macrophage HD11 can be activated by duck Tembusu virus via MyD88-NF-κB-mediated signaling pathway. [Abstract]2023 Oct:285:109867. PMID: 37639898
Pepinh-TRIF TFA purchased from MedChemExpress. Usage Cited in: Vet Microbiol. 2023 Oct:285:109867. [Abstract]
Pepinh-TRIF TFA (5 μM). MyD88 and TRIF mRNA levels were measured by qPCR at 12 h and 24 h post-DTMUV infection.
-
Curr Eye Res
TLR4/TRIF/Caspase-8/Caspase-1 Pathway in Choroidal Endothelial Cells Promotes Choroidal Neovascularization. [Abstract]2025 Feb;50(2):203-212. PMID: 39392113 -
bioRxiv
Dysregulation of innate immunity and cellular metabolism through virus-induced deISGylation. [Abstract]2025 Sep 9:2025.09.08.674928. PMID: 40964244 -
-
Pepinh-TRIF TFA purchased from MedChemExpress. Usage Cited in: bioRxiv. 2023 Apr 25.
Treatment with Pepinh-TRIF TFA (40 μM) significantly inhibited RIPK3 and MLKL phosphorylation and LDH release during LPS-induced necroptosis in PAMs.
Solvent & Solubility
In Vitro:
DMSO : ≥ 100 mg/mL
H2O : 50 mg/mL (Need ultrasonic)
* "≥" means soluble, but saturation unknown.
Purity & Documentation
-
Data Sheet (280 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)