1. GPCR/G Protein
    Neuronal Signaling
  2. CGRP Receptor
  3. PHM-27 (human)

PHM-27 (human) 

Cat. No.: HY-P1072
Handling Instructions

PHM-27 (human) is a human prepro-vasoactive intestinal polypeptide (27 amino acid). PHM-27 (human) is a potent the human calcitonin receptor agonist with an EC50 of 11 nM. PHM-27 (human) efficiently enhances glucose-induced insulin secretion from beta cells by an autocrine mechanism.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

PHM-27 (human) Chemical Structure

PHM-27 (human) Chemical Structure

CAS No. : 118025-43-7

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

PHM-27 (human) is a human prepro-vasoactive intestinal polypeptide (27 amino acid). PHM-27 (human) is a potent the human calcitonin receptor agonist with an EC50 of 11 nM. PHM-27 (human) efficiently enhances glucose-induced insulin secretion from beta cells by an autocrine mechanism[1][2][3].

IC50 & Target

EC50: 11 nM (human calcitonin receptor)[2]

Molecular Weight

2985.41

Formula

C₁₃₅H₂₁₄N₃₄O₄₀S

CAS No.

118025-43-7

Sequence

{His}{Ala}{Asp}{Gly}{Val}{Phe}{Thr}{Ser}{Asp}{Phe}{Ser}{Lys}{Leu}{Leu}{Gly}{Gln}{Leu}{Ser}{Ala}{Lys}{Lys}{Tyr}{Leu}{Glu}{Ser}{Leu}{Met}-NH2

Sequence Shortening

HADGVFTSDFSKLLGQLSAKKYLESLM-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

PHM-27 (human)CGRP ReceptorCalcitonin gene-related peptide receptorCalcitonindiabetespreprovasoactiveintestinalpolypeptideglucoseautocrineInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PHM-27 (human)
Cat. No.:
HY-P1072
Quantity:
MCE Japan Authorized Agent: