Eotaxin-3/CCL26 Protein, Human (sf9)
Eotaxin-3/CCL26 Protein, Human (sf9) is a CC chemokine that binds to chemokine receptors CCR3 or CX3CR1 and is a chemotactic agent for eosinophils and basophils that mediates inflammatory responses. Eotaxin-3/CCL26 Protein, Human (sf9) is a recombinant human Eotaxin-3/CCL26 (M1-L94) protein expressed by Sf9 insect cells
.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Eotaxin-3/CCL26 Protein, Human (sf9) is a CC chemokine that binds to chemokine receptors CCR3 or CX3CR1 and is a chemotactic agent for eosinophils and basophils that mediates inflammatory responses. Eotaxin-3/CCL26 Protein, Human (sf9) is a recombinant human Eotaxin-3/CCL26 (M1-L94) protein expressed by Sf9 insect cells
[1].
Background
CCL26, also known as Eotaxin-3, macrophage inflammatory protein 4-alpha (MIP-4-alpha), a small cytokine of the CC chemokine family, is located on chromosome 7 in the human genome. It is expressed in a variety of tissues, including heart, lung and ovary, and in endothelial cells stimulated by the cytokine interleukin 4. It is chemotactic for eosinophils and basophils and acts by binding to the cell surface chemokine receptor CCR3 or CX3CR1. Among them, CCR3 is a CCR selectively expressed on eosinophils, basophils and some Th2 cells.CCR3 is thought to be associated with Th2-mediated diseases, including AD and asthma, while CX3CR1 is associated with Th1-mediated diseases, such as rheumatoid arthritis, diabetes mellitus, lichen planus and psoriasis. CCL26 may play a dual role in the pathogenesis of allergy and other diseases such as eosinophilic esophagitis and Churg-Strauss syndrome by attracting both CCR3-expressing cells and CX3CR1-expressing cells. In addition, CCL26 also acts as a natural antagonist of CCR1, CCR2 and CCR5[1][2].
In Vitro
CCL26 (1 nM, 18 h) induces eosinophil migration, where eosinophil migration is induced within 6 hours, then migration stabilizes until 12 hours and increases further to 18 hours with no increase after 18 hours. And CCR3 blockade completely inhibits eosinophil migration[2].
In Vivo
CCL26 (human, 5 μg in 4 μL PBS, i.p.) induces calcium mobilization not only through CCR3 but also through CX3CR1 in a PTX-sensitive manner, and induces chemotactic. Besides, it can rapidly recruit mouse eosinophils and intravenously transferred human CD16+ NK cells into the peritoneal cavity in BALB/c mice[3].
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
Q9Y258 (T24-L94)
-
Molecular Construction
-
N-term
-
CCL26 (T24-L94)
Accession # Q9Y258 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL26; MIP-4a; Prev. SCYA26; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 26; Eotaxin-3; Chemokine (C-C Motif) Ligand 26; TSC-1; Small Inducible Cytokine A26; Macrophage Inflammatory Protein 4-Alpha; C-C Motif Chemokine 26; Thymic Stroma Chemoki
-
AA Sequence
TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
-
Predicted Molecular Mass
8.4 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. Marie-Chantal Larose, et al. Correlation between CCL26 production by human bronchial epithelial cells and airway eosinophils: Involvement in patients with severe eosinophilic asthma. J Allergy Clin Immunol. 2015 Oct;136(4):904-13. [Content Brief]
[2]. Véronique Provost, et al. CCL26/eotaxin-3 is more effective to induce the migration of eosinophils of asthmatics than CCL11/eotaxin-1 and CCL24/eotaxin-2. J Leukoc Biol. 2013 Aug;94(2):213-22. [Content Brief]
[3]. Takashi Nakayama, et al. Eotaxin-3/CC chemokine ligand 26 is a functional ligand for CX3CR1. J Immunol. 2010 Dec 1;185(11):6472-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)