1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. Eotaxin-3/CCL26
  6. Eotaxin-3/CCL26 Protein, Human (sf9)

Eotaxin-3/CCL26 Protein, Human (sf9) is a CC chemokine that binds to chemokine receptors CCR3 or CX3CR1 and is a chemotactic agent for eosinophils and basophils that mediates inflammatory responses. Eotaxin-3/CCL26 Protein, Human (sf9) is a recombinant human Eotaxin-3/CCL26 (M1-L94) protein expressed by Sf9 insect cells
.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Verfügbarkeit
50 μg   Angebot einholen  
100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

  • Verweise

Beschreibung

Eotaxin-3/CCL26 Protein, Human (sf9) is a CC chemokine that binds to chemokine receptors CCR3 or CX3CR1 and is a chemotactic agent for eosinophils and basophils that mediates inflammatory responses. Eotaxin-3/CCL26 Protein, Human (sf9) is a recombinant human Eotaxin-3/CCL26 (M1-L94) protein expressed by Sf9 insect cells
[1].

Background

CCL26, also known as Eotaxin-3, macrophage inflammatory protein 4-alpha (MIP-4-alpha), a small cytokine of the CC chemokine family, is located on chromosome 7 in the human genome. It is expressed in a variety of tissues, including heart, lung and ovary, and in endothelial cells stimulated by the cytokine interleukin 4. It is chemotactic for eosinophils and basophils and acts by binding to the cell surface chemokine receptor CCR3 or CX3CR1. Among them, CCR3 is a CCR selectively expressed on eosinophils, basophils and some Th2 cells.CCR3 is thought to be associated with Th2-mediated diseases, including AD and asthma, while CX3CR1 is associated with Th1-mediated diseases, such as rheumatoid arthritis, diabetes mellitus, lichen planus and psoriasis. CCL26 may play a dual role in the pathogenesis of allergy and other diseases such as eosinophilic esophagitis and Churg-Strauss syndrome by attracting both CCR3-expressing cells and CX3CR1-expressing cells. In addition, CCL26 also acts as a natural antagonist of CCR1, CCR2 and CCR5[1][2].

In Vitro

CCL26 (1 nM, 18 h) induces eosinophil migration, where eosinophil migration is induced within 6 hours, then migration stabilizes until 12 hours and increases further to 18 hours with no increase after 18 hours. And CCR3 blockade completely inhibits eosinophil migration[2].

In Vivo

CCL26 (human, 5 μg in 4 μL PBS, i.p.) induces calcium mobilization not only through CCR3 but also through CX3CR1 in a PTX-sensitive manner, and induces chemotactic. Besides, it can rapidly recruit mouse eosinophils and intravenously transferred human CD16+ NK cells into the peritoneal cavity in BALB/c mice[3].

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

Q9Y258 (T24-L94)

Gene ID
Molecular Construction
N-term
CCL26 (T24-L94)
Accession # Q9Y258
C-term
Protein Length

Full Length

Synonyms
C-C motif chemokine 26; MIP-4-alpha; TSC-1; SCYA26
AA Sequence

TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL

Predicted Molecular Mass
8.4 kDa
Reinheit

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Dokumentation
Verweise

Eotaxin-3/CCL26 Protein, Human (sf9) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

Eotaxin-3/CCL26 Protein, Human (sf9)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
Eotaxin-3/CCL26 Protein, Human (sf9)
Art. -Nr.:
HY-P75606
Menge:
MCE Japan Authorized Agent: