GMP BDNF Protein, Human/Mouse/Rat

Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt). BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS. GMP BDNF Protein, Human is a recombinant human BDNF (H129-R247) without tag, which is produced in E.coli.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt)[1]. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB[2]. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS[1]. GMP BDNF Protein, Human is a recombinant human BDNF (H129-R247) without tag, which is produced in E.coli.

Background

BDNF, a neurotrophin that belongs to NGF-beta family. BDNF is widely expressed in the CNS, gut and other tissues. BDNF regulates neurodevelopmental processes, including maturation, survival and differentiation of neuronal populations, and synaptic plasticity[1].
BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt), thereby inducing increased Ca2+ intake and phosphorylation of transcription factors. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB. The activation of p75NTR increases apoptotic and inflammatory signaling in neurons and glial cells by activation of c-Jun N-terminal kinases (JNK) and NF-κB expression, respectively[2]. In human, decreased levels of BDNF are associated with neurodegenerative diseases (such as Parkinson's disease and Alzheimer's disease) and type 2 diabetes mellitus[1]. Human BDNF shares >97% aa sequence identity with mouse and rat. Rat BDNF shares >99% aa sequence identity with mouse.
BDNF is a neurotransmitter modulator which is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory[1].

In Vitro

BDNF (human, 50 ng/mL, 3 days) increases percentage of neurite-bearing cells in PC12 cells[3].

In Vivo

BDNF (human, 0.25 μg/side, intrahippocampal administration) increases ERK1/2 and CREB activation and facilitated LTM in rats[4].

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • BDNF (H129-R247)
      Accession # P23560
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    BDNF; Abrineurin; Brain Derived Neurotrophic Factor; Brain-Derived Neurotrophic Factor Preproprotein Isoform 2; ProBDNF; Brain-Derived Neurotrophic Factor Isoform 1; Neurotrophic Factor BDNF Precursor Form; ANON2; Brain-Derived Neurotrophic Factor; BULN2;

  • AA Sequence

    HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

  • Predicted Molecular Mass

    13 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00