1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 1
  6. IFN-alpha 1/IFNA13 Protein, Human (P.pastoris, His)

IFN-alpha 1/IFNA13 Protein, Human (P.pastoris, His)

Cat. No.: HY-P73245
Handling Instructions Technical Support

IFN-alpha 13 (IFNA1), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 1 involves in the activation of JAK1 and TYK2 pathway, exerts function by inhibiting viral replication as well as modulating immune response. IFN-alpha 1/IFNA13 Protein, Human (P.pastoris, His) is produced in P.pastoris yeast cells with a C-Terminal His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-alpha 13 (IFNA1), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 1 involves in the activation of JAK1 and TYK2 pathway[4], exerts function by inhibiting viral replication as well as modulating immune response[3]. IFN-alpha 1/IFNA13 Protein, Human (P.pastoris, His) is produced in P.pastoris yeast cells with a C-Terminal His tag.

Background

IFN-alpha 13 (IFNA1; IFN-α1), belongs to the alpha/beta interferon family, is produced by macrophages with antiviral activities[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
IFNs binds to one of three type-specific receptors, which leads to the activation of JAK1 and TYK2[3]. This signal transduction results in phosphorylation of STAT1 and STAT2 and eventually in an association with IFN regulatory factor 9 (IRF9) and formation of the IFN-stimulated gene factor 3 (ISGF3) complex. Thus the ISGF3 complex induces transcription of IFN-stimulated genes (ISGs), with subsequent immunomodulatory effects on both innate and adaptive immune responses[4].
The interactions of type I IFN with the immune system is important for the generation of a durable antitumor response through its effects on dendritic cells (DC)[5]. IFN has been widely used for animal disease model, and the sequence of amino acids in IFNA1 protein of human is very different from mouse (62.96%).

In Vitro

IFN-alpha induces highly active dendritic cells (DC) rapidly generated from blood monocytes in vitro, suitable for therapeutic vaccination of cancer research[5].

Species

Human

Source

P. pastoris

Tag

C-His

Accession

P01562 (C24-E189)

Gene ID

3439  [NCBI]/3447  [NCBI]

Molecular Construction
N-term
IFNA1 (C24-E189)
Accession # P01562
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interferon alpha-1/13; IFN-alpha-1/13; LeIF D; IFNA1; IFNA13
AA Sequence

CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Predicted Molecular Mass
20.8 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

IFN-alpha 1/IFNA13 Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IFN-alpha 1/IFNA13 Protein, Human (P.pastoris, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-alpha 1/IFNA13 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P73245
Quantity:
MCE Japan Authorized Agent: