IFN-alpha/beta R2 Protein, Mouse (Biotinylated, HEK293, His, Avi)
IFN-α/β R2 protein and IFNAR1 together constitute the heterodimeric receptor of type I interferon and initiate the JAK-STAT signaling cascade. Upon binding of type I interferons, IFNAR1 and IFNAR2 activate related Janus kinases (TYK2 and JAK1) in proximity, resulting in cross-phosphorylation. IFN-alpha/beta R2 Protein, Mouse (Biotinylated, HEK293, His, Avi) is the recombinant mouse-derived IFN-alpha/beta R2 protein, expressed by HEK293, with C-Avi and C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IFN-α/β R2 protein and IFNAR1 together constitute the heterodimeric receptor of type I interferon and initiate the JAK-STAT signaling cascade. Upon binding of type I interferons, IFNAR1 and IFNAR2 activate related Janus kinases (TYK2 and JAK1) in proximity, resulting in cross-phosphorylation. IFN-alpha/beta R2 Protein, Mouse (Biotinylated, HEK293, His, Avi) is the recombinant mouse-derived IFN-alpha/beta R2 protein, expressed by HEK293, with C-Avi and C-His labeled tag.
Background
The IFN-alpha/beta R2 Protein, in conjunction with IFNAR1, constitutes the heterodimeric receptor for type I interferons, encompassing interferons alpha, beta, epsilon, omega, and kappa. Upon type I interferon binding, the receptor activation initiates the JAK-STAT signaling cascade, leading to the transcriptional activation or repression of interferon-regulated genes that mediate the interferon response. Mechanistically, the binding of type I interferon brings IFNAR1 and IFNAR2 into close proximity, facilitating cross-phosphorylation of their associated Janus kinases (JAKs), with TYK2 bound to IFNAR1 and JAK1 bound to IFNAR2. The activated JAKs then phosphorylate specific tyrosine residues on the intracellular domains of IFNAR1 and IFNAR2, creating docking sites for STAT transcription factors (STAT1, STAT2, and STAT). These phosphorylated STAT proteins translocate into the nucleus, regulating the expression of interferon-regulated genes. Additionally, IFN-alpha/beta R2 proteins may function as potent inhibitors of type I interferon receptor activity, showcasing their role in modulating the interferon signaling pathway.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
O35664-1 (S22-A242)
-
Gene ID15976
-
Molecular Construction
-
N-term
-
IFN-alpha/beta R2 (S22-A242)
Accession # O35664-1 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
IFNAR2; IFN-R-2; Prev. IFNABR; Interferon-Alpha/Beta Receptor Beta Chain; Interferon Alpha/Beta Receptor 2; Human Interferon Alpha/Beta Receptor; Type I Interferon Receptor 2; IFN-Alpha Binding Protein; Interferon (Alpha, Beta And Omega) Receptor 2; Inter
-
AA Sequence
SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA
-
Predicted Molecular Mass
28.3 kDa
-
Molecular Weight
Approximately 50-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)