IFN-gamma R2 Protein, Mouse (HEK293, His, solution)
Based on 2 publication(s) in Google Scholar
IFN-gamma R2, one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R2 is the signal-transducing chain of the IFN-gamma receptor. IFN-gamma R2 forms the functional receptor with IFN-gamma R1. Upon binding with IFN-gamma, IFN-gamma R2 and IFN-gamma R1 oligomerize and transphosphorylate. Then, the downstream signaling components JAK1 and JAK2 are phosphorylated and activated, and STAT1 is phosphorylated. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54). IFN-gamma R2 Protein, Mouse (HEK293, His) is a recombinant mouse IFN-gamma R2 (M1-V243) with C-terminal His tag, which is produced in HEK293 cells.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IFN-gamma R2, one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R2 is the signal-transducing chain of the IFN-gamma receptor. IFN-gamma R2 forms the functional receptor with IFN-gamma R1. Upon binding with IFN-gamma, IFN-gamma R2 and IFN-gamma R1 oligomerize and transphosphorylate[1]. Then, the downstream signaling components JAK1 and JAK2 are phosphorylated and activated, and STAT1 is phosphorylated. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54)[2]. IFN-gamma R2 Protein, Mouse (HEK293, His) is a recombinant mouse IFN-gamma R2 (M1-V243) with C-terminal His tag, which is produced in HEK293 cells.
Background
IFN-gamma R2, one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R2. IFN-gamma R2 is highly expressed on myeloid cells, moderately on B cells and low on T cells, and the expression is regulated by the state of cellular differentiation or activation[2].
IFN-gamma R2 can associate with IFN-gamma R1 to form a functional receptor. Upon binding with IFN-gamma, IFN-gamma R2 and IFN-gamma R1 oligomerize and transphosphorylate[1]. Then, JAK1 and JAK2 are phosphorylated and activated, creating a binding site for STAT1. STAT1 is recruited to the receptor complex and leads to the phosphorylation. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54). IFN-gamma R2 is important for innating immune defense against mycobacterial infections. Defects in IFN-gamma R2 causes mendelian susceptibility to mycobacterial disease (MSMD)[2].
Human IFN-gamma R2 consists of extracellular domain (S28-Q247), helical domain (V248-F268), and cytoplasmic domain (L269-L337).
IFN-gamma R2 plays a critical role in antimicrobial, and immune responses[2].
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Mouse IFN-gamma R1(HY-P72611) is immobilized at 2 μg/mL (100 μL/well), it binds to Recombinant Mouse IFN-gamma R2 in the presence of Recombinant Mouse IFN-gamma(HY-P7071). The ED 50 for this effect is 0.8900 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Mol Med
Dehydrodiisoeugenol targets NOD2 exerting dual effects against colitis and colorectal cancer: a double-edged sword. [Abstract]2025 Jun 5;31(1):221. PMID: 40468178 -
Kaohsiung J Med Sci
Activation of PPARγ regulates M1/M2 macrophage polarization and attenuates dextran sulfate sodium salt-induced inflammatory bowel disease via the STAT-1/STAT-6 pathway. [Abstract]2025 Feb;41(2):e12927. PMID: 39737788
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-10*His
-
Accession
Q63953/NP_032364 (A20-V243)
-
Molecular Construction
-
N-term
-
IFN-gamma R2 (A20-V243)
Accession # Q63953/NP_032364 -
10*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
IFNGR2; CDNA FLJ78008, Highly Similar To Human Clone PSK1 Interferon Gamma Receptor Accessory Factor-1 (AF-1) MRNA; Prev. IFNGT1; Interferon Gamma Receptor 2 (Interferon Gamma Transducer 1); AF-1; Interferon Gamma Receptor Accessory Factor-1; Interferon G
-
AA Sequence
ASSPDSFSQLAAPLNPRLHLYNDEQILTWEPSPSSNDPRPVVYQVEYSFIDGSWHRLLEPNCTDITETKCDLTGGGRLKLFPHPFTVFLRVRAKRGNLTSKWVGLEPFQHYENVTVGPPKNISVTPGKGSLVIHFSPPFDVFHGATFQYLVHYWEKSETQQEQVEGPFKSNSIVLGNLKPYRVYCLQTEAQLILKNKKIRPHGLLSNVSCHETTANASARLQQV
-
Predicted Molecular Mass
26.7 kDa
-
Molecular Weight
Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Castro F, et al. Interferon-Gamma at the Crossroads of Tumor Immune Surveillance or Evasion. Front Immunol. 2018 May 4;9:847. [Content Brief]
[2]. van de Vosse E, et al. IFN-γR1 defects: Mutation update and description of the IFNGR1 variation database. Hum Mutat. 2017 Oct;38(10):1286-1296. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
