IFN-gamma R2 Protein, Mouse (HEK293, His, solution)

IFN-gamma R2, one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R2 is the signal-transducing chain of the IFN-gamma receptor. IFN-gamma R2 forms the functional receptor with IFN-gamma R1. Upon binding with IFN-gamma, IFN-gamma R2 and IFN-gamma R1 oligomerize and transphosphorylate^[1]. Then, the downstream signaling components JAK1 and JAK2 are phosphorylated and activated, and STAT1 is phosphorylated. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54)^[2]. IFN-gamma R2 Protein, Mouse (HEK293, His) is a recombinant mouse IFN-gamma R2 (M1-V243) with C-terminal His tag, which is produced in HEK293 cells.

IFN-gamma R2, one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R2. IFN-gamma R2 is highly expressed on myeloid cells, moderately on B cells and low on T cells, and the expression is regulated by the state of cellular differentiation or activation^[2].
IFN-gamma R2 can associate with IFN-gamma R1 to form a functional receptor. Upon binding with IFN-gamma, IFN-gamma R2 and IFN-gamma R1 oligomerize and transphosphorylate^[1]. Then, JAK1 and JAK2 are phosphorylated and activated, creating a binding site for STAT1. STAT1 is recruited to the receptor complex and leads to the phosphorylation. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54). IFN-gamma R2 is important for innating immune defense against mycobacterial infections. Defects in IFN-gamma R2 causes mendelian susceptibility to mycobacterial disease (MSMD)^[2].
Human IFN-gamma R2 consists of extracellular domain (S28-Q247), helical domain (V248-F268), and cytoplasmic domain (L269-L337).
IFN-gamma R2 plays a critical role in antimicrobial, and immune responses^[2].

Measured by its binding ability in a functional ELISA. When Recombinant Mouse IFN-gamma R1(HY-P72611) is immobilized at 2 μg/mL (100 μL/well), it binds to Recombinant Mouse IFN-gamma R2 in the presence of Recombinant Mouse IFN-gamma(HY-P7071). The ED ₅₀ for this effect is 0.8900 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Mouse IFN-gamma R1 (HY-P72611) is immobilized at 2 μg/mL (100 μL/well), it binds to Recombinant Mouse IFN-gamma R2 in the presence of Recombinant Mouse IFN-gamma (HY-P7071). The ED ₅₀ for this effect is 0.8900 μg/mL.

Mouse

HEK293

C-10*His

Q63953/NP_032364 (A20-V243)

15980  [NCBI]

Partial

ASSPDSFSQLAAPLNPRLHLYNDEQILTWEPSPSSNDPRPVVYQVEYSFIDGSWHRLLEPNCTDITETKCDLTGGGRLKLFPHPFTVFLRVRAKRGNLTSKWVGLEPFQHYENVTVGPPKNISVTPGKGSLVIHFSPPFDVFHGATFQYLVHYWEKSETQQEQVEGPFKSNSIVLGNLKPYRVYCLQTEAQLILKNKKIRPHGLLSNVSCHETTANASARLQQV

40-45 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Castro F, et al. Interferon-Gamma at the Crossroads of Tumor Immune Surveillance or Evasion. Front Immunol. 2018 May 4;9:847.  [Content Brief]

  [2]. van de Vosse E, et al. IFN-γR1 defects: Mutation update and description of the IFNGR1 variation database. Hum Mutat. 2017 Oct;38(10):1286-1296.  [Content Brief]