IL-10R beta Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

IL-10R beta protein is an IL10 cytokine surface receptor involved in IL10-mediated inflammation and immune regulation, as well as viral defense responses.IL-10R beta Protein, Human (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region (W221-F242) with a 6*His tag at the C-terminus.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-10R beta protein is an IL10 cytokine surface receptor involved in IL10-mediated inflammation and immune regulation, as well as viral defense responses.IL-10R beta Protein, Human (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region (W221-F242) with a 6*His tag at the C-terminus[3].

Background

IL-10 receptor complex consists of a heterodimer of four transmembrane chains, two of which form IL-10R alpha and two of which form IL-10R beta. IL-10R beta, originally known as the orphan receptor CRF2-4, is an essential accessory subunit for the active interleukin 10 receptor complex[1].
IL-10R beta can bind to IL-10 via the JAK-STAT pathway, and activation of the IL-10 receptor complex leads to phosphorylation of the receptor-associated proteins TYK and JAK-1, and ultimately to activation of the transcription factors STAT3, STAT1, and STAT5, which regulate the expression of IL-10-responsive genes, including c-myc, bcl-2, and bcl-xL, initiating signal transduction[2].
IL-10R beta is expressed on most cell types and is also a shared cell surface receptor required for the activation of five class II cytokines (IL-10, IL-22, IL-26, IL-28 and IFNL1), which play a key role in host defense, immune regulation. Among them, the IFNLR1/IL10R beta dimer is the receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity[3].

In Vitro

IL-10R beta expression levels increase steadily during neuronal differentiation in human neuronal cells (NT2-N) and can be co-expressed with IL-28Rα, affecting the biological function of cells for IFN-λ[4].

Verified Bioactivity

Immobilized Recombinant Human IL 28 R alpha /IFN lambda R1 at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human IL-10R beta. The ED50 for this effect is 9.714 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-10Rβ (M20-S220)
      Accession # Q08334/NP_000619.3
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    IL10RB; CDW210B; Prev. D21S58; IL-10 Receptor Subunit Beta; Prev. D21S66; IL-10R Subunit Beta; Prev. CRFB4; IL-10R Subunit 2; IL-10R2; IL-10RB; CRF2-4; Cytokine Receptor Family II, Member 4; Interleukin-10 Receptor Subunit Beta; Cytokine Receptor Class-II

  • AA Sequence

    MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPS

  • Molecular Weight

    Approximately 45-48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00