1. Stem Cell/Wnt
  2. YAP
  3. Super-TDU (1-31) TFA

Super-TDU (1-31) TFA 

Cat. No.: HY-P1728A Purity: 96.04%
Handling Instructions

Super-TDU (1-31) is a peptide of Super-TDU, which is an inhibitor of YAP-TEADs, shows potent anti-tumor activity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Super-TDU (1-31) TFA Chemical Structure

Super-TDU (1-31) TFA Chemical Structure

Size Price Stock Quantity
1 mg USD 190 In-stock
Estimated Time of Arrival: December 31
5 mg   Get quote  
10 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Super-TDU (1-31) TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Super-TDU (1-31) is a peptide of Super-TDU, which is an inhibitor of YAP-TEADs, shows potent anti-tumor activity[1].

Molecular Weight

3355.50

Formula

C₁₄₁H₂₁₈N₄₀O₄₈.C₂HF₃O₂

Sequence

Ser-Val-Asp-Asp-His-Phe-Ala-Lys-Ser-Leu-Gly-Asp-Thr-Trp-Leu-Gln-Ile-Gly-Gly-Ser-Gly-Asn-Pro-Lys-Thr-Ala-Asn-Val-Pro-Gln-Thr

Sequence Shortening

SVDDHFAKSLGDTWLQIGGSGNPKTANVPQT

Shipping

Room temperature in continental US; may vary elsewhere

Storage
Protect from light
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Super-TDU (1-31) TFA
Cat. No.:
HY-P1728A
Quantity: