Super-TDU (1-31) TFA
Based on 2 publication(s) in Google Scholar
Super-TDU (1-31) TFA is a peptide fragment of Super-TDU. Super-TDU (1-31) TFA is an inhibitor of YAP-TEAD complex. Super-TDU TFA shows potent anti-tumor activity and suppresses tumor growth in gastric cancer mouse model.
For research use only. We do not sell to patients.
- Purity: 99.27%
- Formula: C141H218N40O48.C2HF3O2
- Molecular Weight:3355.50
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications Citing Use of MedChemExpress (MCE) Super-TDU (1-31) TFA
MoreAll YAP Isoforms
More
Biological Activity
Description
IC50 & Target
|
YAP/TAZ-TEAD |
In Vitro
Super-TDU (1-31) TFA (50 nM; 24-72 hours) can largely compromise the increased cell viability induced by ACTN1 in Huh-7 or LM3 cells proliferation[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:Liver cancer cell lines of human, including Huh-7, LM3 cells
-
Concentration:50 nM
-
Incubation Time:24, 48 and 72 h
-
Result:Could largely compromise the increased cell viability induced by ACTN1.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3355.50
-
Formula C141H218N40O48.C2HF3O2
-
Color White to off-white
-
Sequence Shortening
SVDDHFAKSLGDTWLQIGGSGNPKTANVPQT
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Nat Commun
Hepatic stellate cell stearoyl co-A desaturase activates leukotriene B4 receptor 2 - β-catenin cascade to promote liver tumorigenesis. [Abstract]2023 May 8;14(1):2651. PMID: 37156770 -
Solvent & Solubility
In Vitro:
H2O : 50 mg/mL (14.90 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (270 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Jiao S, et al. A peptide mimicking VGLL4 function acts as a YAP antagonist therapy against gastric cancer. Cancer Cell. 2014 Feb 10;25(2):166-80. [Content Brief]
[2]. Qian Chen, et al. ACTN1 supports tumor growth by inhibiting Hippo signaling in hepatocellular carcinoma. J Exp Clin Cancer Res. 2021 Jan 7;40(1):23. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2980 mL | 1.4901 mL | 2.9802 mL | 7.4505 mL |
| 5 mM | 0.0596 mL | 0.2980 mL | 0.5960 mL | 1.4901 mL | |
| 10 mM | 0.0298 mL | 0.1490 mL | 0.2980 mL | 0.7450 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.