1. Stem Cell/Wnt
  2. YAP
  3. Super-TDU 1-31

Super-TDU 1-31 

Cat. No.: HY-P1728
Handling Instructions

Super-TDU (1-31) is a peptide of Super-TDU, which is an inhibitor of YAP-TEADs, shows potent anti-tumor activity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Super-TDU 1-31 Chemical Structure

Super-TDU 1-31 Chemical Structure

Size Price Stock
1 mg USD 190 Get quote

* Please select Quantity before adding items.

Customer Review

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Information

  • References

Description

Super-TDU (1-31) is a peptide of Super-TDU, which is an inhibitor of YAP-TEADs, shows potent anti-tumor activity[1].

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
Molecular Weight

3241.48

Formula

C₁₄₁H₂₁₈N₄₀O₄₈

Sequence

SVDDHFAKSLGDTWLQIGGSGNPKTANVPQT

Sequence Shortening

Ser-Val-Asp-Asp-His-Phe-Ala-Lys-Ser-Leu-Gly-Asp-Thr-Trp-Leu-Gln-Ile-Gly-Gly-Ser-Gly-Asn-Pro-Lys-Thr-Ala-Asn-Val-Pro-Gln-Thr

Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Super-TDU 1-31
Cat. No.:
HY-P1728
Quantity:

Super-TDU 1-31

Cat. No.: HY-P1728