Super-TDU (1-31)
Based on 2 publication(s) in Google Scholar
Super-TDU (1-31) is a peptide fragment of Super-TDU. Super-TDU (1-31) is an inhibitor of YAP-TEAD complex. Super-TDU shows potent anti-tumor activity and suppresses tumor growth in gastric cancer mouse model.
For research use only. We do not sell to patients.
- Formula: C141H218N40O48
- Molecular Weight:3241.48
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) Super-TDU (1-31)
MoreAll YAP Isoforms
More
Biological Activity
|
YAP/TAZ-TEAD |
Super-TDU (1-31) (50 nM; 24-72 hours) can largely compromise the increased cell viability induced by ACTN1 in Huh-7 or LM3 cells proliferation[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:Liver cancer cell lines of human, including Huh-7, LM3 cells
-
Concentration:50 nM
-
Incubation Time:24, 48 and 72 h
-
Result:Could largely compromise the increased cell viability induced by ACTN1.
Chemical Information
-
Molecular Weight 3241.48
-
Formula C141H218N40O48
-
Sequence
Ser-Val-Asp-Asp-His-Phe-Ala-Lys-Ser-Leu-Gly-Asp-Thr-Trp-Leu-Gln-Ile-Gly-Gly-Ser-Gly-Asn-Pro-Lys-Thr-Ala-Asn-Val-Pro-Gln-Thr
-
Sequence Shortening
SVDDHFAKSLGDTWLQIGGSGNPKTANVPQT
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Nat Commun
Hepatic stellate cell stearoyl co-A desaturase activates leukotriene B4 receptor 2 - β-catenin cascade to promote liver tumorigenesis. [Abstract]2023 May 8;14(1):2651. PMID: 37156770 -
Purity & Documentation
References
[1]. Jiao S, et al. A peptide mimicking VGLL4 function acts as a YAP antagonist therapy against gastric cancer. Cancer Cell. 2014 Feb 10;25(2):166-80. [Content Brief]
[2]. Qian Chen, et al. ACTN1 supports tumor growth by inhibiting Hippo signaling in hepatocellular carcinoma. J Exp Clin Cancer Res. 2021 Jan 7;40(1):23. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Super-TDU (1-31) Related Classifications
HY-P1728 Related Classifications
Powered by Bioz