Super-TDU (1-31)

Cat. No.: HY-P1728: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Super-TDU (1-31) is a peptide fragment of Super-TDU. Super-TDU (1-31) is an inhibitor of YAP-TEAD complex. Super-TDU shows potent anti-tumor activity and suppresses tumor growth in gastric cancer mouse model.

For research use only. We do not sell to patients.

Super-TDU (1-31) Chemical Structure

Size		Stock
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Super-TDU (1-31):

Other Forms of Super-TDU (1-31):

Super-TDU (1-31) (TFA) In-stock

2 Publications Citing Use of MCE Super-TDU (1-31)

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

In Vitro

Super-TDU (1-31) (50 nM; 24-72 hours) can largely compromise the increased cell viability induced by ACTN1 in Huh-7 or LM3 cells proliferation^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Viability Assay^[2]

Cell Line:	Liver cancer cell lines of human, including Huh-7, LM3 cells
Concentration:	50 nM
Incubation Time:	24, 48 and 72 h
Result:	Could largely compromise the increased cell viability induced by ACTN1.

Molecular Weight

3241.48

Formula

C₁₄₁H₂₁₈N₄₀O₄₈

Sequence

Ser-Val-Asp-Asp-His-Phe-Ala-Lys-Ser-Leu-Gly-Asp-Thr-Trp-Leu-Gln-Ile-Gly-Gly-Ser-Gly-Asn-Pro-Lys-Thr-Ala-Asn-Val-Pro-Gln-Thr

Sequence Shortening

SVDDHFAKSLGDTWLQIGGSGNPKTANVPQT

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Handling Instructions (2659 KB)

References

[1]. Jiao S, et al. A peptide mimicking VGLL4 function acts as a YAP antagonist therapy against gastric cancer. Cancer Cell. 2014 Feb 10;25(2):166-80. [Content Brief]

[2]. Qian Chen, et al. ACTN1 supports tumor growth by inhibiting Hippo signaling in hepatocellular carcinoma. J Exp Clin Cancer Res. 2021 Jan 7;40(1):23. [Content Brief]

Super-TDU (1-31) Related Classifications

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Super-TDU (1-31)YAPYes-associated proteinYAP-TEADgastric cancerACTN1Huh-7LM3 cellInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks