Tamapin TFA
Based on 1 Customer Validation
Tamapin TFA is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin TFA is a selctive blocker of SK2 (Potassium Channel). Tamapin TFA inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin TFA can be isolated from the Indian red scorpion (Mesobuthus tamulus).
Para uso exclusivo en investigación. No vendemos a pacientes.
- Pureza : 98.79%
- Fòrmula: C146H238N44O41S6.xC2HF3O2
- Peso molecular:3458.11 (free base)
-
Almacenamiento:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
-
Solvente y solubilidad
- Pureza y Documentación
- Referencias
-
Help & FAQs
Actividad biológica
Descripciòn
Chemical Information
-
Appearance Solid
-
Peso molecular 3458.11 (free base)
-
Fòrmula C146H238N44O41S6.xC2HF3O2
-
Color White to off-white
-
Sequence
Ala-Phe-Cys-Asn-Leu-Arg-Arg-Cys-Glu-Leu-Ser-Cys-Arg-Ser-Leu-Gly-Leu-Leu-Gly-Lys-Cys-Ile-Gly-Glu-Glu-Cys-Lys-Cys-Val-Pro-Tyr-NH2 (Disulfide bridge: Cys3-Cys21, Cys8-Cys26, Cys12-Cys28)
-
Sequence Shortening
AFCNLRRCELSCRSLGLLGKCIGEECKCVPY-NH2 (Disulfide bridge: Cys3-Cys21, Cys8-Cys26, Cys12-Cys28)
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Solvente y solubilidad
In Vitro:
DMSO : ≥ 50 mg/mL
* "≥" means soluble, but saturation unknown.
Pureza y Documentación
-
Ficha de datos (269 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Tamapin TFA Related Classifications
HY-P5154A Related Classifications
Powered by Bioz