β-Amyloid-15N (1-40) TFA
β-Amyloid-15N (1-40) (TFA) is the 15N-labledβ-Amyloid (1-40) (TFA). β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease.
For research use only. We do not sell to patients.
- Formula: C194H295N5215NO58S.xC2HF3O2
- Molecular Weight:4330.86 (free acid)
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Stable heavy isotopes of hydrogen, carbon, and other elements have been incorporated into drug molecules, largely as tracers for quantitation during the drug development process. Deuteration has gained attention because of its potential to affect the pharmacokinetic and metabolic profiles of drugs[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
1. This compound can be used as a tracer
2. This compound can be used as an internal standard for quantitative analysis by NMR, GC-MS, or LC-MS.
Chemical Information
-
Molecular Weight 4330.86 (free acid)
-
Formula C194H295N5215NO58S.xC2HF3O2
-
Synonyms
Amyloid Beta-Peptide-15N (1-40) (human) TFA; Amyloid β-Peptide-15N (1-40) (human) TFA
-
Sequence
Asp-Ala-{Glu-15N}-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val (TFA)
-
Sequence Shortening
DA-{Glu-15N}-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (TFA)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Shoji M, et al. Cerebrospinal fluid Abeta40 and Abeta42: natural course and clinical usefulness. Front Biosci. 2002 Apr 1;7:d997-1006. [Content Brief]
[2]. Russak EM, et al. Impact of Deuterium Substitution on the Pharmacokinetics of Pharmaceuticals. Ann Pharmacother. 2019;53(2):211-216. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
β-Amyloid-15N (1-40) TFA Related Classifications
HY-P0265AS Related Classifications
Powered by Bioz