APP669-711
APP669-711 is an N-terminally extended amyloid β peptide (Aβ (-3)-40) that forms amyloid fibrils and co-deposits with Aβ in brain plaques, and also serves as a plasma biomarker for assessing brain Aβ load. APP669-711 can be used in research on Alzheimer's disease.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C210H325N57O61S2
- Masse moléculaire:4688.30
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Protocole
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
Description
In Vitro
APP669-711 is produced in HEK293A cells by APPwt and c102 in a DAPT-sensitive manner, is upregulated by ADAMTS4, and is abolished by the Swedish mutation[1].
APP669-711 production in HEK293A cells is enhanced to a greater extent by ADAMTS5 co-expression than by ADAMTS4, requires the ADAMTS5 Sp domain, and is abolished by the E411A catalytic mutation or an ADAMTS5 inhibitor; exogenous ADAMTS5 conditioned medium does not significantly increase APP669-711[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Masse moléculaire 4688.30
-
Formule C210H325N57O61S2
-
Sequence
Val-Lys-Met-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
-
Sequence Shortening
VKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
APP669-711 Related Classifications
HY-P10487 Related Classifications
Powered by Bioz