APP669-711
APP669-711 is an N-terminally extended amyloid β peptide (Aβ (-3)-40) that forms amyloid fibrils and co-deposits with Aβ in brain plaques, and also serves as a plasma biomarker for assessing brain Aβ load. APP669-711 can be used in research on Alzheimer's disease.
For research use only. We do not sell to patients.
- Formula: C210H325N57O61S2
- Molecular Weight:4688.30
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Protocols
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
In Vitro
APP669-711 production in HEK293A cells is enhanced to a greater extent by ADAMTS5 co-expression than by ADAMTS4, requires the ADAMTS5 Sp domain, and is abolished by the E411A catalytic mutation or an ADAMTS5 inhibitor; exogenous ADAMTS5 conditioned medium does not significantly increase APP669-711[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Molecular Weight 4688.30
-
Formula C210H325N57O61S2
-
Sequence
Val-Lys-Met-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
-
Sequence Shortening
VKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
APP669-711 Related Classifications
HY-P10487 Related Classifications
Powered by Bioz