VSTx-3
VSTx-3 is a KV channel blocker. VSTx-3 is demonstrated to be a potent, TTX-sensitive sodium channel blocker and especially, a potent blocker of NaV1.8 channels (IC50 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7 and 0.77 μM for hNaV1.8 channels).
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C182H261N51O51S6
- Masse moléculaire:4171.72
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
Chemical Information
-
Masse moléculaire 4171.72
-
Formule C182H261N51O51S6
-
Synonyms
κ-Theraphotoxin-Gr4a; Kappa-TRTX-Gr4a; Voltage sensor toxin 3; Peptide F
-
Sequence
Asp-Cys-Leu-Gly-Trp-Phe-Lys-Gly-Cys-Asp-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Glu-Gly-Tyr-Lys-Cys-Asn-Arg-Arg-Asp-Lys-Trp-Cys-Lys-Tyr-Lys-Leu-Trp (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
-
Sequence Shortening
DCLGWFKGCDPDNDKCCEGYKCNRRDKWCKYKLW (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
VSTx-3 Related Classifications
HY-P5916 Related Classifications
Powered by Bioz