country

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P6013A

Copy Link Print Information

wt hMLN TFA

Avis client

Based on 1 Customer Validation

wt hMLN (TFA) is a microprotein that inhibits of SR Ca²⁺ pump (SERCA). wt hMLN plays an important role in skeletal muscle calcium homeostasis.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Pureté: 95.0%
Formule: C₂₄₅H₄₀₄N₅₄O₆₆S..xC2HF3O2
Masse moléculaire:5194.22 (free acid)

Stockage:

Sealed storage, away from moisture and light.

Powder -80°C, 2 years , -20°C, 1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

wt hMLN TFA Chemical Structure

Size

Prix

Stock

Quantité

Sample (0.1mg)

In-stock

(In Japan)

Apply Now

Obtenir un devis Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability Obtenir un devis Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability

Bulk Inquiry

Amount: USD 0.00

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Activité biologique

Description

wt hMLN (TFA) is a microprotein that inhibits of SR Ca²⁺ pump (SERCA). wt hMLN plays an important role in skeletal muscle calcium homeostasis^[1].

Voir tous les produits spécifiques à Isoform Calcium Channel :

Chemical Information

Appearance Solid
Masse moléculaire 5194.22 (free acid)
Formule C₂₄₅H₄₀₄N₅₄O₆₆S..xC2HF3O2
Color White to off-white
Sequence

Met-Thr-Gly-Lys-Asn-Trp-Ile-Leu-Ile-Ser-Thr-Thr-Thr-Pro-Lys-Ser-Leu-Glu-Asp-Glu-Ile-Val-Gly-Arg-Leu-Leu-Lys-Ile-Leu-Phe-Val-Ile-Phe-Val-Asp-Leu-Ile-Ser-Ile-Ile-Tyr-Val-Val-Ile-Thr-Ser (TFA salt)
Sequence Shortening

MTGKNWILISTTTPKSLEDEIVGRLLKILFVIFVDLISIIYVVITS (TFA salt)
Livraison

Room temperature in continental US; may vary elsewhere.

Stockage

Sealed storage, away from moisture and light

Powder	-80°C	2 years
	-20°C	1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Pureté et documentation

Select Batch:

Pureté: 99.98%

Assay: 99.98%

ee.: 99.98%

Fiche technique (264 KB)
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Portuguese - PT (252 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instruction de manipulation (2659 KB)

Références

[1]. Alexis Boulinguiez, et al. NR1D1 controls skeletal muscle calcium homeostasis through myoregulin repression. JCI Insight. 2022 Sep 8; 7(17): e153584.

Calculators

Calculateur de molarité

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculateur de dilution

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Obtenir un devis En stock

Price: USD 0.00

Activité biologique
- Description
Chemical Information
Pureté et documentation
Références

Nom du produit:
Cat. No.:
Quantité:
MCE Japan Authorized Agent:

Nom du produit:
CAS No.:
Species:
Pureté:
Quantité: