country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Art. -Nr.: HY-P11457

Copy Link Print Information

cCBD-LL37

cCBD-LL37 is a chimeric antimicrobial peptide modified with a collagen-binding domain (cCBD) (TKKTLRT). cCBD-LL37 has improved retention on collagen after PBS washing and varying electrostatic conditions. cCBD-LL37 binds to collagen involves both specific and non-specific interactions, initiated by long-range electrostatic forces that transitions to close range or hydrophobic interactions. cCBD-LL37 has potent antimicrobial activity with improved structural stability under different ionic strengths and pH conditions (pH 5.5-8). cCBD-LL37 can be used for biomaterials like collagen-based wound dressings research.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

CAS. Nr.: 2378579-44-1
Formel: C₂₈₂H₄₆₆N₈₂O₈₂
Molecular Weight:6317.22

Speicherung:

Please store the product under the recommended conditions in the Certificate of Analysis.

cCBD-LL37 Chemical Structure

CAS. Nr.: 2378579-44-1

Größe

Preis

Verfügbarkeit

Menge

Amount: USD 0.00

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biologische Aktivität

Beschreibung

Chemical Information

CAS. Nr. 2378579-44-1
Molecular Weight 6317.22
Formel C₂₈₂H₄₆₆N₈₂O₈₂
Sequence

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-Thr-Lys-Lys-Thr-Leu-Arg-Thr
Sequence Shortening

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT
Versand

Room temperature in continental US; may vary elsewhere.
Speicherung

Please store the product under the recommended conditions in the Certificate of Analysis.

Reinheit & Dokumentation

Select Batch:

Reinheit: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (259 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

Verweise

[1]. Wei Z, et al. Characterization of LL37 Binding to Collagen through Peptide Modification with a Collagen-Binding Domain. ACS Omega. 2023 Sep 14;8(38):35370-35381. [Content Brief]

Calculators

Molaritätsrechner

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Konzentration Konzentration

Volumen Volumen

Molecular Weight Molecular Weight

Verdünnungsrechner

Konzentration _{(Stammlösung)} × Volumen _{(Stammlösung)} = Konzentration _{(Ziellösung)} × Volumen _{(Ziellösung)}

Konzentration _{(Stammlösung)} Konzentration _{(Stammlösung)}

Volumen _{(Stammlösung)} Volumen _{(Stammlösung)}

Konzentration _{(Ziellösung)} Konzentration _{(Ziellösung)}

Volumen _{(Ziellösung)} Volumen _{(Ziellösung)}

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Angebot einholen Auf Lager