country

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Art. -Nr.: HY-P3089A

Copy Link Print Information

Dendrotoxin K TFA

Kundenbewertung

Based on 1 Customer Validation

Dendrotoxin K TFA is a Kv1.1 channel blocker. Dendrotoxin K TFA determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Reinheit: 99.84%
Formel: C₂₉₄H₄₆₂N₈₄O₇₅S₆.XC₂HF₃OC₂
Molecular Weight:6559.66 (free base)

Speicherung:

Sealed storage, away from moisture and light, under nitrogen.

Powder -80°C, 2 years , -20°C, 1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Dendrotoxin K TFA Chemical Structure

Größe

Preis

Verfügbarkeit

Menge

Amount: USD 0.00

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biologische Aktivität

Beschreibung

Dendrotoxin K TFA is a Kv1.1 channel blocker. Dendrotoxin K TFA determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform^[1].

Chemical Information

Appearance Solid
Molecular Weight 6559.66 (free base)
Formel C₂₉₄H₄₆₂N₈₄O₇₅S₆.XC₂HF₃OC₂
Color White to off-white
Sequence

Ala-Ala-Lys-Tyr-Cys-Lys-Leu-Pro-Leu-Arg-Ile-Gly-Pro-Cys-Lys-Arg-Lys-Ile-Pro-Ser-Phe-Tyr-Tyr-Lys-Trp-Lys-Ala-Lys-Gln-Cys-Leu-Pro-Phe-Asp-Tyr-Ser-Gly-Cys-Gly-Gly-Asn-Ala-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Val-Gly (Disulfide bridge:Cys5-Cys55,Cys14-Cys38,Cys30-Cys51)
Sequence Shortening

AAKYCKLPLRIGPCKRKIPSFYYKWKAKQCLPFDYSGCGGNANRFKTIEECRRTCVG (Disulfide bridge:Cys5-Cys55,Cys14-Cys38,Cys30-Cys51)
Versand

Room temperature in continental US; may vary elsewhere.

Speicherung

Sealed storage, away from moisture and light, under nitrogen

Powder	-80°C	2 years
	-20°C	1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Reinheit & Dokumentation

Select Batch:

Reinheit: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (269 KB)
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Portuguese - PT (252 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

Verweise

[1]. Bialowas A, et al. Analog modulation of spike-evoked transmission in CA3 circuits is determined by axonal Kv1.1 channels in a time-dependent manner. Eur J Neurosci. 2015 Feb;41(3):293-304. [Content Brief]

Calculators

Molaritätsrechner

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Konzentration Konzentration

Volumen Volumen

Molecular Weight Molecular Weight

Verdünnungsrechner

Konzentration _{(Stammlösung)} × Volumen _{(Stammlösung)} = Konzentration _{(Ziellösung)} × Volumen _{(Ziellösung)}

Konzentration _{(Stammlösung)} Konzentration _{(Stammlösung)}

Volumen _{(Stammlösung)} Volumen _{(Stammlösung)}

Konzentration _{(Ziellösung)} Konzentration _{(Ziellösung)}

Volumen _{(Ziellösung)} Volumen _{(Ziellösung)}

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Angebot einholen Auf Lager