Noxiustoxin
Noxiustoxin is a toxin from the venom of the Mexican scorpion Centruroides noxius which block voltage-dependent potassium channel (Kv1.3, IC50 = 360 nM), and calcium-activated potassium channel. Noxiustoxin plays an important role in neuroinflammatory disease.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 85205-49-8
- Formel: C174H286N52O54S7
- Molecular Weight:4195.00
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
- Reinheit & Dokumentation
- Verweise
-
Help & FAQs
Biologische Aktivität
Chemical Information
-
CAS. Nr. 85205-49-8
-
Molecular Weight 4195.00
-
Formel C174H286N52O54S7
-
Sequence
Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Ser-Lys-Pro-Cys-Lys-Glu-Leu-Tyr-Gly-Ser-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Asn-Asn-NH2 (Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36)
-
Sequence Shortening
TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN-NH2 (Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Reinheit & Dokumentation
Verweise
[1]. M Dauplais, et al. Determination of the Three-Dimensional Solution Structure of Noxiustoxin: Analysis of Structural Differences with Related Short-Chain Scorpion Toxins. Biochemistry.1995 Dec 26;34(51):16563-73. [Content Brief]
[2]. H H Valdivia, et al. Charybdotoxin and noxiustoxin, two homologous peptide inhibitors of the K+(Ca2+) channel. FEBS Lett. 1988 Jan 4;226(2):280-4. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Noxiustoxin Related Classifications
HY-P2710 Related Classifications
Powered by Bioz