GIP, rat
GIP, rat is a bioactive peptide derived from rats. GIP, rat inhibits GIP-mediated postprandial insulin release as well as GIP-promoted glucose uptake in the upper small intestine. GIP, rat can be used in research related to insulin resistance, glucose intolerance, and type 2 diabetes.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C226H343N61O66S
- Masse moléculaire:5002.58
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
GIP, rat (4 h) stimulates cAMP-dependent β-galactosidase production in LGIPR2 cells, with maximum activity observed at a concentration of 10-8 M following 4 h of incubation[5].
GIP, rat binds to GIP receptors on stably transfected L293 cells with an IC50 of 7 nM[5].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Wistar (male, 250-350 g, fasted for 20 h prior to experimentation, anesthetized with sodium pentobarbital)[3]
-
Dosage:0.9 μg immunoreactive rat GIP·kg-1·h-1
-
Administration:i.v.; continuous infusion; 90 minutes
-
Result:Nearly doubled glucose-induced insulin release, with plasma insulin reaching 178 mU/l at 30 minutes and 171 mU/l at 90 minutes.
Trebled integrated 90-minute insulin response (13.67 mU/mL vs. 4.52 mU/mL for glucose alone).
Significantly reduced integrated 90-minute glucose response (0.28 mol/l vs. 0.53 mol/l for glucose alone).
Raised peak plasma immunoreactive GIP from a basal level of 239 pg/mL to 983 pg/mL at 30 minutes.
Chemical Information
-
Masse moléculaire 5002.58
-
Formule C226H343N61O66S
-
Sequence
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Leu-Thr-Gln
-
Sequence Shortening
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation
Références
[1]. Tseng CC, et al. Effect of GIP and GLP-1 antagonists on insulin release in the rat. The American journal of physiology. 1999 Jun;276(6):E1049-54. [Content Brief]
[2]. Wewer Albrechtsen NJ, et al. The intestinal distribution pattern of appetite- and glucose regulatory peptides in mice, rats and pigs. BMC research notes. 2016 Feb 02;9:60. [Content Brief]
[3]. Ebert R, et al. Preservation of incretin activity after removal of gastric inhibitory polypeptide (GIP) from rat gut extracts by immunoadsorption. Diabetologia. 1983 Jun;24(6):449-54. [Content Brief]
[4]. Gniuli D, et al. High-fat feeding stimulates endocrine, glucose-dependent insulinotropic polypeptide (GIP)-expressing cell hyperplasia in the duodenum of Wistar rats. Diabetologia. 2010 Oct;53(10):2233-40. [Content Brief]
[5]. Tseng CC, et al. Postprandial stimulation of insulin release by glucose-dependent insulinotropic polypeptide (GIP). Effect of a specific glucose-dependent insulinotropic polypeptide receptor antagonist in the rat. J Clin Invest. 1996 Dec 1;98(11):2440-5. [Content Brief]
[6]. Widenmaier SB, et al. A GIP receptor agonist exhibits beta-cell anti-apoptotic actions in rat models of diabetes resulting in improved beta-cell function and glycemic control. PloS one. 2010 Mar 09;5(3):e9590. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
GIP, rat Related Classifications
HY-P5390 Related Classifications
Powered by Bioz