Animal-Free BDNF Protein, Human/Mouse/Rat (His)
Based on 1 publication(s) in Google Scholar
Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt). BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS. Animal-Free BDNF Protein, Human/Mouse (His) is an animal-free recombinant human/muose BDNF (H129-R247) with C-terminal His tag, which is produced in E.coli.This product is for cell culture use only.
- Species: Rat; Mouse; Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt)[1]. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB[2]. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS[1]. Animal-Free BDNF Protein, Human/Mouse (His) is an animal-free recombinant human/muose BDNF (H129-R247) with C-terminal His tag, which is produced in E.coli.This product is for cell culture use only.
Background
BDNF, a neurotrophin that belongs to NGF-beta family. BDNF is widely expressed in the CNS, gut and other tissues. BDNF regulates neurodevelopmental processes, including maturation, survival and differentiation of neuronal populations, and synaptic plasticity[1].
BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt), thereby inducing increased Ca2+ intake and phosphorylation of transcription factors. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB. The activation of p75NTR increases apoptotic and inflammatory signaling in neurons and glial cells by activation of c-Jun N-terminal kinases (JNK) and NF-κB expression, respectively[2]. In human, decreased levels of BDNF are associated with neurodegenerative diseases (such as Parkinson's disease and Alzheimer's disease) and type 2 diabetes mellitus[1]. Human BDNF shares >97% aa sequence identity with mouse and rat. Rat BDNF shares >99% aa sequence identity with mouse.
BDNF is a neurotransmitter modulator which is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory[1].
In Vitro
BDNF (human, 50 ng/mL, 3 days) increases percentage of neurite-bearing cells in PC12 cells[3].
In Vivo
BDNF (human, 0.25 μg/side, intrahippocampal administration) increases ERK1/2 and CREB activation and facilitated LTM in rats[4].
Verified Bioactivity
Measure by its ability to induce proliferation in BaF3 cells transfected with TrkB. The ED50 for this effect is <2 ng/mL
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Neuroscience
Brain-derived neurotrophic factor in the ventrolateral orbital cortex regulates spared nerve injury-induced neuropathic pain and related emotional disorders in mice. [Abstract]2025 Aug 20:584:250-263. PMID: 40846211
Technical Parameters
-
Species Rat; Mouse; Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P23560-1 (H129-R247)/P21237-1 (H131-R249)/P23363 (H131-R249)
-
Molecular Construction
-
N-term
-
BDNF (H129-R247)
Accession # P23560-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Neurotrophic factor BDNF Chain
-
Synonyms
BDNF; Abrineurin; Brain Derived Neurotrophic Factor; Brain-Derived Neurotrophic Factor Preproprotein Isoform 2; ProBDNF; Brain-Derived Neurotrophic Factor Isoform 1; Neurotrophic Factor BDNF Precursor Form; ANON2; Brain-Derived Neurotrophic Factor; BULN2;
-
AA Sequence
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
-
Predicted Molecular Mass
14.5 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Bathina S, et al. Brain-derived neurotrophic factor and its clinical implications. Arch Med Sci. 2015 Dec 10;11(6):1164-78. [Content Brief]
[2]. Lima Giacobbo B, et al. Brain-Derived Neurotrophic Factor in Brain Disorders: Focus on Neuroinflammation. Mol Neurobiol. 2019 May;56(5):3295-3312. [Content Brief]
[3]. Egan MF, et al. The BDNF val66met polymorphism affects activity-dependent secretion of BDNF and human memory and hippocampal function. Cell. 2003 Jan 24;112(2):257-69. [Content Brief]
[4]. Alonso M, et al. Signaling mechanisms mediating BDNF modulation of memory formation in vivo in the hippocampus. Cell Mol Neurobiol. 2002 Dec;22(5-6):663-74. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
