Abaecin
Based on 1 Customer Validation
Abaecin is an antibacterial response peptide. Abaecin shows specific activity against an Apidaecin-resistant Xanthomonas strain.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Pureza : 98.29%
- No. CAS: 123997-18-2
- Fòrmula: C187H270N48O43
- Peso molecular:3878.44
-
Almacenamiento:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
-
Solvente y solubilidad
- Protocolo
- Pureza y Documentación
- Referencias
-
Help & FAQs
Actividad biológica
Descripciòn
Chemical Information
-
No. CAS 123997-18-2
-
Appearance Solid
-
Peso molecular 3878.44
-
Fòrmula C187H270N48O43
-
Color White to off-white
-
Sequence
Tyr-Val-Pro-Leu-Pro-Asn-Val-Pro-Gln-Pro-Gly-Arg-Arg-Pro-Phe-Pro-Thr-Phe-Pro-Gly-Gln-Gly-Pro-Phe-Asn-Pro-Lys-Ile-Lys-Trp-Pro-Gln-Gly-Tyr
-
Sequence Shortening
YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY
-
Structure Classification
-
Initial Source
Apis mellifera
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvente y solubilidad
In Vitro:
DMSO : 50 mg/mL (12.89 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Pureza y Documentación
-
Ficha de datos (274 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2578 mL | 1.2892 mL | 2.5784 mL | 6.4459 mL |
| 5 mM | 0.0516 mL | 0.2578 mL | 0.5157 mL | 1.2892 mL | |
| 10 mM | 0.0258 mL | 0.1289 mL | 0.2578 mL | 0.6446 mL |
Abaecin Related Classifications
HY-P5714 Related Classifications
Powered by Bioz