country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Referencia número: HY-P5739

Copy Link Print Information

Mram 8

Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family.

Para uso exclusivo en investigación. No vendemos a pacientes.

No. CAS: 1803183-45-0
Fòrmula: C₁₃₂H₂₀₈N₃₆O₃₉S₆
Peso molecular:3115.67

Almacenamiento:

Please store the product under the recommended conditions in the Certificate of Analysis.

Mram 8 Chemical Structure

No. CAS: 1803183-45-0

Tamaño

Precio

Stock

Cantidad

Amount: USD 0.00

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Actividad biológica

Descripciòn

Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family^[1].

Chemical Information

No. CAS 1803183-45-0
Peso molecular 3115.67
Fòrmula C₁₃₂H₂₀₈N₃₆O₃₉S₆
Sequence

Cyclo(Ala-Ile-Gly-Cys-Ser-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Arg-Asn-Gly-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Leu-Thr-Ser) (Disulfide bridge: Cys4-Cys18,Cys6-Cys22,Cys11-Cys27)
Sequence Shortening

Cyclo(AIGCSCKSKVCYRNGIPCGESCVFIPCLTS) (Disulfide bridge: Cys4-Cys18,Cys6-Cys22,Cys11-Cys27)
Envío

Room temperature in continental US; may vary elsewhere.
Almacenamiento

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureza y Documentación

Select Batch:

Pureza: 99.98%

Assay: 99.98%

ee.: 99.98%

Ficha de datos (258 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instrucciones de manejo (2659 KB)

Referencias

[1]. He W, et al. Isolation and characterization of cytotoxic cyclotides from Viola philippica. Peptides. 2011 Aug;32(8):1719-23. [Content Brief]

Calculators

Calculadora de molaridad

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculadora de dilución

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Obtener un presupuesto En stock