VSTx-3
VSTx-3 is a KV channel blocker. VSTx-3 is demonstrated to be a potent, TTX-sensitive sodium channel blocker and especially, a potent blocker of NaV1.8 channels (IC50 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7 and 0.77 μM for hNaV1.8 channels).
Para uso exclusivo en investigación. No vendemos a pacientes.
- Fòrmula: C182H261N51O51S6
- Peso molecular:4171.72
-
Almacenamiento:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
- Pureza y Documentación
- Referencias
-
Help & FAQs
Actividad biológica
Chemical Information
-
Peso molecular 4171.72
-
Fòrmula C182H261N51O51S6
-
Synonyms
κ-Theraphotoxin-Gr4a; Kappa-TRTX-Gr4a; Voltage sensor toxin 3; Peptide F
-
Sequence
Asp-Cys-Leu-Gly-Trp-Phe-Lys-Gly-Cys-Asp-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Glu-Gly-Tyr-Lys-Cys-Asn-Arg-Arg-Asp-Lys-Trp-Cys-Lys-Tyr-Lys-Leu-Trp (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
-
Sequence Shortening
DCLGWFKGCDPDNDKCCEGYKCNRRDKWCKYKLW (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureza y Documentación
Referencias
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
VSTx-3 Related Classifications
HY-P5916 Related Classifications
Powered by Bioz