GluN1(356-385)
Based on 1 Customer Validation
GluN1 (356-385) is a polypeptide targeting NMDAR GluN1. GluN1 (356-385) induces the production of autoantibodies, which reduce the density of cell surface NMDAR clusters, impair long-term potentiation, and decrease NMDAR-mediated Ca2+ influx. As an immunogen, GluN1 (356-385) induces symptoms similar to anti-NMDAR encephalitis, including memory loss, in mice. GluN1 (356-385) can be used to establish a mouse model that mimics the pathogenesis of anti-NMDAR encephalitis. GluN1 (356-385) is applicable to research related to anti-NMDAR encephalitis.
For research use only. We do not sell to patients.
- Purity: 99.95%
- Formula: C154H248N46O42
- Molecular Weight:3415.90
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
GluN1(356-385)-induced antibody (24 h) reduce the density of surface GluN1-positive synaptic clusters and decrease membrane GluN1 levels in primary hippocampal neurons from embryonic day 18 rats[1].
GluN1(356-385)-induced antibody (18 h at 37 °C) significantly reduces NMDAR-mediated calcium influx in primary rat hippocampal neurons on embryonic day 18[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:C57BL/6 (female, 10 weeks old, induced by active immunization with GluN1(356-385) peptide)[1]
-
Dosage:200 μg
-
Administration:s.c.; initial immunization on back, followed by two booster injections at 4 and 8 weeks after initial immunization
-
Result:Showed significant memory loss, with decreased exploration time of a novel object and a lower discrimination index in the novel object recognition test .
Reduced visits to strangers in the three-chamber test.
Reduced hippocampal membrane GluN1 levels.
Impaired long-term potentiation (LTP) at Schaffer collateral-CA1 synapses, with a normalized field excitatory postsynaptic potential slope of 112% compared to 143% in controls.
Induced autoantibodies targeting GluN1 in cerebrospinal fluid and serum, maintained at high titers through the 12-week period, and localized primarily to the hippocampus and cerebellum.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3415.90
-
Formula C154H248N46O42
-
Color White to off-white
-
Sequence
Leu-Gln-Asn-Arg-Lys-Leu-Val-Gln-Val-Gly-Ile-Tyr-Asn-Gly-Thr-His-Val-Ile-Pro-Asn-Asp-Arg-Lys-Ile-Ile-Trp-Pro-Gly-Gly-Glu
-
Sequence Shortening
LQNRKLVQVGIYNGTHVIPNDRKIIWPGGE
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
DMSO : 66.67 mg/mL (19.52 mM; ultrasonic and adjust pH to 3 with 1 M HCl; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
0.1 M Acetic acid : 25 mg/mL (7.32 mM; Need ultrasonic)
H2O : < 0.1 mg/mL (insoluble)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (280 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| 0.1 M Acetic acid / DMSO | 1 mM | 0.2927 mL | 1.4637 mL | 2.9275 mL | 7.3187 mL |
| 5 mM | 0.0585 mL | 0.2927 mL | 0.5855 mL | 1.4637 mL | |
| DMSO | 10 mM | 0.0293 mL | 0.1464 mL | 0.2927 mL | 0.7319 mL |
| 15 mM | 0.0195 mL | 0.0976 mL | 0.1952 mL | 0.4879 mL |
Powered by Bioz