GluN1(356-385) 

GluN1 (356-385) is a polypeptide targeting NMDAR GluN1. GluN1 (356-385) induces the production of autoantibodies, which reduce the density of cell surface NMDAR clusters, impair long-term potentiation, and decrease NMDAR-mediated Ca²⁺ influx. As an immunogen, GluN1 (356-385) induces symptoms similar to anti-NMDAR encephalitis, including memory loss, in mice. GluN1 (356-385) can be used to establish a mouse model that mimics the pathogenesis of anti-NMDAR encephalitis. GluN1 (356-385) is applicable to research related to anti-NMDAR encephalitis^[1].

GluN1(356-385)-induced antibody (24 h) reduce the density of surface GluN1-positive synaptic clusters and decrease membrane GluN1 levels in primary hippocampal neurons from embryonic day 18 rats^[1].
GluN1(356-385)-induced antibody (18 h at 37 °C) significantly reduces NMDAR-mediated calcium influx in primary rat hippocampal neurons on embryonic day 18^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

GluN1(356-385) (200 μg; subcutaneous injection; first immunized at the back, followed by two booster injections at 4 weeks and 8 weeks after the initial immunization) induces anti-GluN1 encephalitis in female C57BL/6 mice, resulting in significant memory impairment, reduced hippocampal membrane GluN1 levels, and impaired hippocampal LTP^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

3415.90

C₁₅₄H₂₄₈N₄₆O₄₂

Solid

White to off-white

Leu-Gln-Asn-Arg-Lys-Leu-Val-Gln-Val-Gly-Ile-Tyr-Asn-Gly-Thr-His-Val-Ile-Pro-Asn-Asp-Arg-Lys-Ile-Ile-Trp-Pro-Gly-Gly-Glu

LQNRKLVQVGIYNGTHVIPNDRKIIWPGGE

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

• [1]. Ding Y, et al. Anti-NMDAR encephalitis induced in mice by active immunization with a peptide from the amino-terminal domain of the GluN1 subunit. J Neuroinflammation. 2021;18(1):53. Published 2021 Feb 21.  [Content Brief]