JNJ63955918
JNJ63955918 is a potent, highly selective, blocked-state Nav1.7 blocking peptide with an IC50 of 8.0 nM. JNJ63955918 can be used in pain research.
For research use only. We do not sell to patients.
- Formula: C164H259N47O44S8
- Molecular Weight:3849.62
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Protocols
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
IC50 & Target
|
h Nav1.7 8.0 nM (IC50) |
Chemical Information
-
Molecular Weight 3849.62
-
Formula C164H259N47O44S8
-
Sequence
Gly-Pro-Tyr-Cys-Gln-Lys-Trp-Met-Gln-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Met-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Lys-Leu-Leu (Disulfide bridge: Cys4-Cys18;Cys11-Cys23;Cys17-Cys27)
-
Sequence Shortening
GPYCQKWMQTCDSERKCCEGMVCRLWCKKKLL (Disulfide bridge:Cys4-Cys18;Cys11-Cys23;Cys17-Cys27)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocols
-
Cell Cytotoxicity Assay
Cytotoxicity assays are usually based on the assessment of cell membrane damage, which can also be indirectly detected by measuring cell viability. Detection methods include MTT assay, CKK-8 assay, LDH assay and ATP assay, etc.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
JNJ63955918 Related Classifications
HY-P11045 Related Classifications
Powered by Bioz