country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P11457

Copy Link Print Information

cCBD-LL37

cCBD-LL37 is a chimeric antimicrobial peptide modified with a collagen-binding domain (cCBD) (TKKTLRT). cCBD-LL37 has improved retention on collagen after PBS washing and varying electrostatic conditions. cCBD-LL37 binds to collagen involves both specific and non-specific interactions, initiated by long-range electrostatic forces that transitions to close range or hydrophobic interactions. cCBD-LL37 has potent antimicrobial activity with improved structural stability under different ionic strengths and pH conditions (pH 5.5-8). cCBD-LL37 can be used for biomaterials like collagen-based wound dressings research.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

CAS No.: 2378579-44-1
화학식: C₂₈₂H₄₆₆N₈₂O₈₂
분자량:6317.22

보관:

Please store the product under the recommended conditions in the Certificate of Analysis.

cCBD-LL37 Chemical Structure

CAS No.: 2378579-44-1

사이즈

가격

재고

수량

Amount: USD 0.00

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

제품 설명

Chemical Information

CAS No. 2378579-44-1
분자량 6317.22
화학식 C₂₈₂H₄₆₆N₈₂O₈₂
Sequence

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-Thr-Lys-Lys-Thr-Leu-Arg-Thr
Sequence Shortening

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT
선적

Room temperature in continental US; may vary elsewhere.
보관

Please store the product under the recommended conditions in the Certificate of Analysis.

순도&문서

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (259 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Wei Z, et al. Characterization of LL37 Binding to Collagen through Peptide Modification with a Collagen-Binding Domain. ACS Omega. 2023 Sep 14;8(38):35370-35381. [Content Brief]

Calculators

몰농도 계산기

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

농도 희석 계산기

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

견적 받기 해외재고보유