CDKN1B Protein, Human (His)

고객리뷰

Based on 1 Customer Validation

The CDKN1B protein is a key cell cycle regulator that inhibits CDK2 when bound to cyclin A, thereby inhibiting G1 phase progression. It exhibits significant inhibitory effects on cyclin E- and cyclin A-CDK2 complexes. CDKN1B Protein, Human (His) is the recombinant human-derived CDKN1B protein, expressed by E. coli , with N-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
  • Species: Human
  • Source: E. coli
  • 보관:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • 각종 서류
  • Help & FAQs

Biological Activity

제품 설명

The CDKN1B protein is a key cell cycle regulator that inhibits CDK2 when bound to cyclin A, thereby inhibiting G1 phase progression. It exhibits significant inhibitory effects on cyclin E- and cyclin A-CDK2 complexes. CDKN1B Protein, Human (His) is the recombinant human-derived CDKN1B protein, expressed by E. coli , with N-6*His labeled tag.

Background

The CDKN1B protein serves as a pivotal regulator in cell cycle progression, exerting its influence through multifaceted interactions and activities. Acting as a potent inhibitor, CDKN1B restrains the kinase activity of CDK2 when bound to cyclin A, while exhibiting lesser inhibitory effects on CDK2 associated with SPDYA. This protein is intricately involved in G1 arrest and displays a pronounced inhibitory impact on cyclin E- and cyclin A-CDK2 complexes. Notably, it forms complexes with cyclin type D-CDK4, playing a crucial role in their assembly, stability, and modulation of CCND1-CDK4 complex activation. The phosphorylation state and stoichiometry of CDKN1B determine whether it functions as an inhibitor or activator of cyclin type D-CDK4 complexes. Additionally, CDKN1B engages in diverse interactions, including those with proteins such as CCNE1, COPS5, NUP50, 14-3-3, AKT1, LYN, CDK2, SPDYA, cyclin D, CDK4, GRB2, PIM1, SKP1, SKP2, CKS1B, UHMK1, and CDK1, highlighting its versatility in modulating cell cycle dynamics. Notably, its dephosphorylation on Thr-187 by PPM1H contributes to CDKN1B stability.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • CDKN1B (M1-T198)
      Accession # P46527
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CDKN1B; P27Kip1; Cyclin Dependent Kinase Inhibitor 1B; Truncated Cyclin-Dependent Kinase Inhibitor 1B; KIP1; MEN1B; Cyclin-Dependent Kinase Inhibitor 1B; CDKN4; P27KIP1; MEN4; Cyclin-Dependent Kinase Inhibitor 1B (P27, Kip1); P27; Cyclin-Dependent Kinase

  • AA Sequence

    MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT

  • Predicted Molecular Mass

    24.2 kDa

  • 분자량

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
농도 희석 계산기

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

견적 받기 해외재고보유

Other size
견적 받기
Please select quantity
Amount: USD 0.00