Copy Link Print Information

PPAR alpha Protein, Human (His)

2 Cited Publications
고객리뷰

Based on 2 publication(s) in Google Scholar

PPAR alpha Protein, human (His), a member of the nuclear receptor family, is a transcription factor that regulates the expression of genes related to lipid metabolism in a ligand-dependent manner.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
  • Species: Human
  • Source: E. coli
  • 보관:
    Stored at 4°C for 6 months from date of receipt. Recommend aliquoting the protein into smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for PPAR alpha Protein, Human (His)
  • Experimental Validation Results for PPAR alpha Protein, Human (His)
  • PPAR alpha Protein, Human (His) Product Image
사이즈
가격
재고
수량
Amount: USD 0.00
Please select quantity
or
or

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
주변의 대리점 찾기 Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • 각종 서류
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

제품 설명

PPAR alpha Protein, human (His), a member of the nuclear receptor family, is a transcription factor that regulates the expression of genes related to lipid metabolism in a ligand-dependent manner.

Background

Peroxisome proliferator-activated receptors (PPARs) are ligand-dependent transcription factors that belong to the nuclear receptor superfamily comprising 48 members in human. PPARs include three subtypes, PPARα, PPARγ, and PPARδ. PPARα is involved in lipid homeostasis by regulating the transcription of sets of genes related to lipid metabolism and thereby reducing blood triglyceride levels. PPARα has attracted attention as a target for hypolipidemic drugs[1].

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    Q07869-1 (D202-Y468)

  • Gene ID
    5465  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • PPAR alpha (D202-Y468)
      Accession # Q07869-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PPARA; HPPAR; Prev. PPAR; PPAR-Alpha; Peroxisome Proliferator-Activated Receptor Alpha; Alternative Protein PPARA; NR1C1; PPARalpha; Nuclear Receptor Subfamily 1 Group C Member 1; Peroxisome Proliferator Activated Receptor Alpha; Peroxisome Proliferative Activated Receptor, Alpha

  • AA Sequence

    DLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY

  • 분자량

    Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, 2 M Urea.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at 4°C for 6 months from date of receipt. Recommend aliquoting the protein into smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with blue ice.

References

[1]. Takuji Oyama, et al. Crystal Structures of the Human Peroxisome Proliferator-Activated Receptor (PPAR)α Ligand-Binding Domain in Complexes with a Series of Phenylpropanoic Acid Derivatives Generated by a Ligand-Exchange Soaking Method. Biol Pharm Bull. 2021;44(9):1202-1209. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
농도 희석 계산기

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

견적 받기 해외재고보유

Other size
견적 받기
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    PPAR alpha Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Phytomedicine. 2025 Nov:147:157213. [Abstract]

    Customer Validation
     Surface plasmon resonance (SPR) results of QCT and PPARA (PPAR alpha Protein, Human (His), HY-P7996, 50 μg/mL)/PPARG(PPAR gamma Protein, Human (His), HY-P7999, 10 μg/mL) proteins. The results showed that the corresponding dissociation constant (KKD) of QCT binding to PPARA was 7.10 μM, and that of QCT binding to PPARG was 12.24 μM, confirming the binding interaction between QCT and PPARA/PPARG.

  • PPAR alpha Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for PPAR alpha Protein, Human (His)
  • Experimental Validation Results for PPAR alpha Protein, Human (His)
  • PPAR alpha Protein, Human (His) Product Image

  • PPAR alpha Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Phytomedicine. 2025 Nov:147:157213. [Abstract]

    Surface plasmon resonance (SPR) results of QCT and PPARA (PPAR alpha Protein, Human (His), HY-P7996, 50 μg/mL)/PPARG(PPAR gamma Protein, Human (His), HY-P7999, 10 μg/mL) proteins. The results showed that the corresponding dissociation constant (KKD) of QCT binding to PPARA was 7.10 μM, and that of QCT binding to PPARG was 12.24 μM, confirming the binding interaction between QCT and PPARA/PPARG.