country

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5689

Copy Link Print Information

Maximin 42

Maximin 42 is an antimicrobial peptide. Maximin 42 has antibacterial activity against S. aureus (MIC: 37.5 μg/mL). Maximin 42 has hemolytic activities against human red cells.

For research use only. We do not sell to patients.

Formula: C₁₃₉H₂₂₃N₃₃O₃₄
Molecular Weight:2900.46

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Maximin 42 Chemical Structure

Size

Price

Stock

Quantity

Sample (0.1mg)

In-stock

(In Japan)

Apply Now

Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability

Bulk Inquiry

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

Maximin 42 is an antimicrobial peptide. Maximin 42 has antibacterial activity against S. aureus (MIC: 37.5 μg/mL). Maximin 42 has hemolytic activities against human red cells^[1].

Chemical Information

Molecular Weight 2900.46
Formula C₁₃₉H₂₂₃N₃₃O₃₄
Sequence

Ser-Ile-Gly-Ala-Lys-Ile-Leu-Gly-Gly-Val-Lys-Thr-Phe-Phe-Lys-Gly-Ala-Leu-Lys-Glu-Leu-Ala-Phe-Thr-Tyr-Leu-Gln-NH2
Sequence Shortening

SIGAKILGGVKTFFKGALKELAFTYLQ-NH2
Structure Classification
- Ketones, Aldehydes, Acids
Initial Source
- Animals
Bombina
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (257 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Liu R, et al. There are abundant antimicrobial peptides in brains of two kinds of Bombina toads. J Proteome Res. 2011 Apr 1;10(4):1806-15. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock