Melanostatin, frog
Melanostatin, frog is an inhibitor for α-melanocyte-stimulating hormone (α-MSH) release, with an IC50 of 60 nM.
For research use only. We do not sell to patients.
- CAS No.: 134709-16-3
- Formula: C189H285N53O57S
- Molecular Weight:4243.67
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Melanostatin, frog (1 μM) increases the potassium current, decreases the sodium and calcium currents, and thus hyperpolarizes the cell membrane[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 134709-16-3
-
Molecular Weight 4243.67
-
Formula C189H285N53O57S
-
Sequence
Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Lys-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
-
Sequence Shortening
YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Valentijn JA, et al., Melanostatin (NPY) inhibited electrical activity in frog melanotrophs through modulation of K+, Na+ and Ca2+ currents. J Physiol. 1994 Mar 1;475(2):185-95. [Content Brief]
[2]. Chartrel N, et al., Characterization of melanotropin-release-inhibiting factor (melanostatin) from frog brain: homology with human neuropeptide Y. Proc Natl Acad Sci U S A. 1991 May 1;88(9):3862-6. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Melanostatin, frog Related Classifications
HY-P10265 Related Classifications
Powered by Bioz