country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5851

Copy Link Print Information

AaHI

AaHI is a neurotoxin that can be obtained from the venom of the North African scorpion Androctonus australis hector. AaHI can be used as a tool for the development of active substances with toxin-neutralizing capabilities.

For research use only. We do not sell to patients.

CAS No.: 820981-26-8
Formula: C₂₉₃H₄₅₂N₈₂O₈₉S₈
Molecular Weight:6803.80

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

AaHI Chemical Structure

CAS No.: 820981-26-8

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

Chemical Information

CAS No. 820981-26-8
Molecular Weight 6803.80
Formula C₂₉₃H₄₅₂N₈₂O₈₉S₈
Sequence

Lys-Arg-Asp-Gly-Tyr-Ile-Val-Tyr-Pro-Asn-Asn-Cys-Val-Tyr-His-Cys-Val-Pro-Pro-Cys-Asp-Gly-Leu-Cys-Lys-Lys-Asn-Gly-Gly-Ser-Ser-Gly-Ser-Cys-Ser-Phe-Leu-Val-Pro-Ser-Gly-Leu-Ala-Cys-Trp-Cys-Lys-Asp-Leu-Pro-Asp-Asn-Val-Pro-Ile-Lys-Asp-Thr-Ser-Arg-Lys-Cys-Thr (Disulfide bridge:Cys12-Cys62;Cys16-Cys34;Cys20-Cys44;Cys24-Cys46)
Sequence Shortening

KRDGYIVYPNNCVYHCVPPCDGLCKKNGGSSGSCSFLVPSGLACWCKDLPDNVPIKDTSRKCT (Disulfide bridge:Cys12-Cys62;Cys16-Cys34;Cys20-Cys44;Cys24-Cys46)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (260 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Devaux C, et al. Construction and functional evaluation of a single-chain antibody fragment that neutralizes toxin AahI from the venom of the scorpion Androctonus australis hector. Eur J Biochem. 2001 Feb;268(3):694-702. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

MOQ

Minimum order quantity

100 mg

Get Quote In-stock

Other size

Get Quote