OD1
Based on 1 Customer Validation
OD1 is a scorpion α-toxin that can be isolated from the venom of the Iranian yellow scorpion (Odonthobuthus doriae. OD1 is a modulator of mammalian Nav1.7 (EC50: 4.5 nM).
For research use only. We do not sell to patients.
- Purity: 99.40%
- Formula: C308H466N90O95S8
- Molecular Weight:7206.06
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
EC50: 4.5 nM (Nav1.7)[1]
Chemical Information
-
Appearance Solid
-
Molecular Weight 7206.06
-
Formula C308H466N90O95S8
-
Color White to off-white
-
Sequence
Gly-Val-Arg-Asp-Ala-Tyr-Ile-Ala-Asp-Asp-Lys-Asn-Cys-Val-Tyr-Thr-Cys-Ala-Ser-Asn-Gly-Tyr-Cys-Asn-Thr-Glu-Cys-Thr-Lys-Asn-Gly-Ala-Glu-Ser-Gly-Tyr-Cys-Gln-Trp-Ile-Gly-Arg-Tyr-Gly-Asn-Ala-Cys-Trp-Cys-Ile-Lys-Leu-Pro-Asp-Glu-Val-Pro-Ile-Arg-Ile-Pro-Gly-Lys-Cys-Arg-NH2 (Disulfide bridge: Cys13-Cys64, Cys17-Cys37, Cys23-Cys47, Cys27-Cys49)
-
Sequence Shortening
GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR-NH2 (Disulfide bridge: Cys13-Cys64, Cys17-Cys37, Cys23-Cys47, Cys27-Cys49)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
DMSO : 100 mg/mL (13.88 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (312 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Durek T, et al. Chemical engineering and structural and pharmacological characterization of the α-scorpion toxin OD1. ACS Chem Biol. 2013;8(6):1215-22. [Content Brief]
[2]. Salvage SC, et al. The β3-subunit modulates the effect of venom peptides ProTx-II and OD1 on NaV 1.7 gating. J Cell Physiol. 2023 Jun;238(6):1354-1367. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.1388 mL | 0.6939 mL | 1.3877 mL | 3.4693 mL |
| 5 mM | 0.0278 mL | 0.1388 mL | 0.2775 mL | 0.6939 mL | |
| 10 mM | 0.0139 mL | 0.0694 mL | 0.1388 mL | 0.3469 mL |