Pepinh-TRIF TFA
Based on 10 publication(s) in Google Scholar
Pepinh-TRIF (TFA) is a 30 aa peptide that blocks TIR-domain-containing adapter-inducing interferon-β (TRIF) signaling by interfering with TLR-TRIF interaction.
For research use only. We do not sell to patients.
- Purity: 99.79%
- Formula: C177H273N55O40S2.xC2HF3O2
- Molecular Weight:3875.54 (free base)
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications Citing Use of MedChemExpress (MCE) Pepinh-TRIF TFA
More- Adv Funct Mater. 2025 Aug 3.
- Adv Sci (Weinh). 2025 Oct 27:e13775. [Abstract]
- Antiviral Res. 2024 Feb:222:105797. [Abstract]
- PeerJ. 2024 Jan 2:12:e16716. [Abstract]
- Vet Microbiol. 2026 Jul:318:111032. [Abstract]
- Vet Microbiol. 2023 Oct:285:109867. [Abstract]
- Curr Eye Res. 2025 Feb;50(2):203-212. [Abstract]
- bioRxiv. 2025 Sep 9:2025.09.08.674928. [Abstract]
- Res Sq. 2025 Jul 17.
- bioRxiv. 2023 Apr 25.
Biological Activity
|
TLRs |
Pepinh-TRIF (40 μM, 6 hours) blocks the expression and production of IL-33 stimulated by polyI:C or flagellin, and also greatly suppresses the stimulated IκB-α phosphorylation and degradation in HCECs[1].
Pepinh-TRIF (40 μM, 6 hours) suppresses NF-κB activation with p65 protein nuclear translocation [1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:HCECs
-
Concentration:40 μM
-
Incubation Time:6 hours
-
Result:Blocked NF-κB activation with p65 nuclear translocation.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3875.54 (free base)
-
Formula C177H273N55O40S2.xC2HF3O2
-
Color White to off-white
-
Sequence
Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Phe-Cys-Glu-Glu-Phe-Gln-Val-Pro-Gly-Arg-Gly-Glu-Leu-His-NH2
-
Sequence Shortening
RQIKIWFQNRRMKWKKFCEEFQVPGRGELH-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications (10)
-
Journal Impact Factor
-
Most Recent
-
-
Adv Sci (Weinh)
VDLIN: A Deep Learning-Based Platform for Methylcobalamin-Inspired Immunomodulatory Compound Screening. [Abstract]2025 Oct 27:e13775. PMID: 41144841 -
Antiviral Res
PZR suppresses innate immune response to RNA viral infection by inhibiting MAVS activation in interferon signaling mediated by RIG-I and MDA5. [Abstract]2024 Feb:222:105797. PMID: 38185222 -
PeerJ
The role of TRIF protein in regulating the proliferation and antigen presentation ability of myeloid dendritic cells through the ERK1/2 signaling pathway in chronic low-grade inflammation of intestinal mucosa mediated by flagellin-TLR5 complex signal. [Abstract]2024 Jan 2:12:e16716. PMID: 38188180 -
Vet Microbiol
TRIF signaling is essential for the activation of dendritic cells during porcine rotavirus infection. [Abstract]2026 Jul:318:111032. PMID: 42054951 -
Vet Microbiol
M1 polarization of chicken macrophage HD11 can be activated by duck Tembusu virus via MyD88-NF-κB-mediated signaling pathway. [Abstract]2023 Oct:285:109867. PMID: 37639898 -
Curr Eye Res
TLR4/TRIF/Caspase-8/Caspase-1 Pathway in Choroidal Endothelial Cells Promotes Choroidal Neovascularization. [Abstract]2025 Feb;50(2):203-212. PMID: 39392113 -
bioRxiv
Dysregulation of innate immunity and cellular metabolism through virus-induced deISGylation. [Abstract]2025 Sep 9:2025.09.08.674928. PMID: 40964244 -
-
Solvent & Solubility
DMSO : ≥ 100 mg/mL
H2O : 50 mg/mL (Need ultrasonic)
* "≥" means soluble, but saturation unknown.
Purity & Documentation
-
Data Sheet (280 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)