1. Immunology/Inflammation
  2. Toll-like Receptor (TLR)
  3. Pepinh-TRIF TFA

Pepinh-TRIF TFA 

Cat. No.: HY-P2565
Handling Instructions

Pepinh-TRIF (TFA) is a 30 aa peptide that blocks TIR-domain-containing adapter-inducing interferon-β (TRIF) signaling by interfering with TLR-TRIF interaction.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Pepinh-TRIF TFA Chemical Structure

Pepinh-TRIF TFA Chemical Structure

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Pepinh-TRIF (TFA) is a 30 aa peptide that blocks TIR-domain-containing adapter-inducing interferon-β (TRIF) signaling by interfering with TLR-TRIF interaction[1].

In Vitro

Pepinh-TRIF (40 μM, 6 hours) blocks the expression and production of IL-33 stimulated by polyI:C or flagellin, and also greatly suppresses the stimulated IκB-α phosphorylation and degradation in HCECs[1].
Pepinh-TRIF (40 μM, 6 hours) suppresses NF-κB activation with p65 protein nuclear translocation [1].

Western Blot Analysis[1]

Cell Line: HCECs
Concentration: 40 μM
Incubation Time: 6 hours
Result: Blocked NF-κB activation with p65 nuclear translocation.
Molecular Weight

4016.63

Formula

C₁₈₀H₂₇₉F₃N₅₈O₄₀S₂

Sequence Shortening

RQIKIWFQNRRMKWKKFCEEFQVPGRGELH-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Pepinh-TRIFToll-like Receptor (TLR)peptideTRIFTIR-domain-containingadapter-inducinginterferon-βTLRtoll-likereceptorInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Pepinh-TRIF TFA
Cat. No.:
HY-P2565
Quantity:
MCE Japan Authorized Agent: