1. Membrane Transporter/Ion Channel Apoptosis
  2. Sodium Channel Apoptosis
  3. Psalmotoxin 1

Psalmotoxin 1  (Synonyms: PcTx1; Psalmopoeus cambridgei toxin-1)

Cat. No.: HY-P1411 Purity: 99.02%
Handling Instructions Technical Support

Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H+ of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Psalmotoxin 1

Psalmotoxin 1 Chemical Structure

CAS No. : 880107-52-8

Size Price Stock Quantity
100 μg In-stock

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 6 publication(s) in Google Scholar

Other Forms of Psalmotoxin 1:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H+ of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease[1][3][4][6].

IC50 & Target

IC50: 0.9 nM (ASIC1a), 50 nM (ASIC1b, ASIC2a, and ASIC3)[6].

In Vitro

Psalmotoxin 1 (20 nM, 125 s) inhibits ASIC1a currents by drastically shifting the steady-state desensitization curve to lower H+ concentrations[1].
? Psalmotoxin 1 (30 nM) competes with Ca2+ in binding to ASIC1a channels[1].
? Psalmotoxin 1 (100 or 200 ng, 24-72 h) significantly weakens the migration, proliferation and invasion of MCF-7 and MDA-MB-231 cells[4].
? Psalmotoxin 1 (100 ng/mL, 24 h) significantly inhibits acid-induced increases in intracellular calcium and LDH release, induces cell apoptosis and cell cycle arrest in nucleus pulposus cells (NPCs)[5].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Proliferation Assay[4]

Cell Line: MCF-7 and MDA-MB-231 cells
Concentration: 100 or 200 ng
Incubation Time: 24, 48, 72 h
Result: Inhibited the cell migration, proliferation and invasion of breast cancer cells.

Western Blot Analysis[5]

Cell Line: Nucleus pulposus cells (NPCs)
Concentration: 100 ng/mL
Incubation Time: 24 h
Result: Decreased Bax and cleaved caspase-3 expression, and increased Bcl-2 expression.
In Vivo

Psalmotoxin 1 (i.c.v., 1 ng/kg, a single dose) is neuroprotective in a conscious model of stroke via direct inhibition of ASIC1a[2].
? Psalmotoxin 1 (tail vein injection, 10 ng/kg, daily for 7 days) inhibits tumor growth in breast cancer mice model[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Male spontaneously hypertensive rats (SHR)[2]
Dosage: 1 ng/kg, a single dose.
Administration: Intracerebroventricular (i.c.v.) injection
Result: Reduced cortical and striatal infarct volumes measured 72 h post-stroke.
Reduced the severity of motor deficit at 1 and 3 days after stroke compared to control rats.
Displayed an anti-apoptotic effect in the occluded hemisphere (reduced stroke-induced caspase-3 positive cells).
Animal Model: Female nude BALB/C mice (orthotopic implantation, MCF-7 and MDA-MB-231 cells)[3]
Dosage: 10 ng/kg, daily for 7 days.
Administration: Tail vein injection
Result: Inhibited breast tumor growth.
Molecular Weight

4689.39

Formula

C200H312N62O57S6

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33)

Sequence Shortening

EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
Purity & Documentation

Purity: 99.02%

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Psalmotoxin 1
Cat. No.:
HY-P1411
Quantity:
MCE Japan Authorized Agent: