Psalmotoxin 1
Based on 7 publication(s) in Google Scholar
Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H+ of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease.
For research use only. We do not sell to patients.
- Purity: 99.20%
- CAS No.: 880107-52-8
- Formula: C200H312N62O57S6
- Molecular Weight:4689.39
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) Psalmotoxin 1
More- Cell Mol Biol Lett. 2024 Dec 3;29(1):149. [Abstract]
- Redox Rep. 2026 Dec;31(1):2618396. [Abstract]
- CNS Neurosci Ther. 2026 May;32(5):e70918. [Abstract]
- Int Immunopharmacol. 2024 Nov 15;143(Pt 3):113623. [Abstract]
- Toxicology. 2025 Jan 3:154045. [Abstract]
- J Venom Anim Toxins Incl Trop Dis. 2024 Sep 2:30:e20230099. [Abstract]
- Aging (Albany NY). 2021 Apr 6;13(7):10703-10723. [Abstract]
Biological Activity
Description
IC50 & Target
IC50: 0.9 nM (ASIC1a), 50 nM (ASIC1b, ASIC2a, and ASIC3)[6].
In Vitro
Psalmotoxin 1 (20 nM, 125 s) inhibits ASIC1a currents by drastically shifting the steady-state desensitization curve to lower H+ concentrations[1].
?
Psalmotoxin 1 (30 nM) competes with Ca2+ in binding to ASIC1a channels[1].
?
Psalmotoxin 1 (100 or 200 ng, 24-72 h) significantly weakens the migration, proliferation and invasion of MCF-7 and MDA-MB-231 cells[4].
?
Psalmotoxin 1 (100 ng/mL, 24 h) significantly inhibits acid-induced increases in intracellular calcium and LDH release, induces cell apoptosis and cell cycle arrest in nucleus pulposus cells (NPCs)[5].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:MCF-7 and MDA-MB-231 cells
-
Concentration:100 or 200 ng
-
Incubation Time:24, 48, 72 h
-
Result:Inhibited the cell migration, proliferation and invasion of breast cancer cells.
-
Cell Line:Nucleus pulposus cells (NPCs)
-
Concentration:100 ng/mL
-
Incubation Time:24 h
-
Result:Decreased Bax and cleaved caspase-3 expression, and increased Bcl-2 expression.
In Vivo
? Psalmotoxin 1 (tail vein injection, 10 ng/kg, daily for 7 days) inhibits tumor growth in breast cancer mice model[4].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Male spontaneously hypertensive rats (SHR)[2]
-
Dosage:1 ng/kg, a single dose.
-
Administration:Intracerebroventricular (i.c.v.) injection
-
Result:Reduced cortical and striatal infarct volumes measured 72 h post-stroke.
Reduced the severity of motor deficit at 1 and 3 days after stroke compared to control rats.
Displayed an anti-apoptotic effect in the occluded hemisphere (reduced stroke-induced caspase-3 positive cells).
-
Animal Model:Female nude BALB/C mice (orthotopic implantation, MCF-7 and MDA-MB-231 cells)[3]
-
Dosage:10 ng/kg, daily for 7 days.
-
Administration:Tail vein injection
-
Result:Inhibited breast tumor growth.
Chemical Information
-
CAS No. 880107-52-8
-
Appearance Solid
-
Molecular Weight 4689.39
-
Formula C200H312N62O57S6
-
Color White to off-white
-
Synonyms
PcTx1; Psalmopoeus cambridgei toxin-1
-
Sequence
Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33)
-
Sequence Shortening
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (7)
-
Journal Impact Factor
-
Most Recent
-
Cell Mol Biol Lett
Acid-sensing ion channel-1 contributes to the failure of myelin sheath regeneration following spinal cord injury by transcellular delivery of PGE2. [Abstract]2024 Dec 3;29(1):149. PMID: 39627718 -
Redox Rep
Acid-sensing ion channel 1a contributes to the calcium/calmodulin-dependent ferroptosis and aggravates intervertebral disc degeneration. [Abstract]2026 Dec;31(1):2618396. PMID: 41558682 -
CNS Neurosci Ther
Inhibition of ASIC1a Attenuates Neuronal Pyroptosis and Neuroinflammation Following Traumatic Brain Injury. [Abstract]2026 May;32(5):e70918. PMID: 42138476 -
Int Immunopharmacol
ASIC1a regulates airway epithelial cell pyroptosis in acute lung injury by NLRP3-Caspase1-GSDMD pathway. [Abstract]2024 Nov 15;143(Pt 3):113623. PMID: 39549550 -
Toxicology
Acidosis induces autophagic cell death through ASIC1-mediated Akt/mTOR signaling in HT22 neurons. [Abstract]2025 Jan 3:154045. PMID: 39756784 -
J Venom Anim Toxins Incl Trop Dis
Identification and analgesic activity study of analgesic protein Ⅶ-2 from Naja naja atra venom. [Abstract]2024 Sep 2:30:e20230099. PMID: 39280840 -
Aging (Albany NY)
ASIC1 and ASIC3 mediate cellular senescence of human nucleus pulposus mesenchymal stem cells during intervertebral disc degeneration. [Abstract]2021 Apr 6;13(7):10703-10723. PMID: 33824228
Solvent & Solubility
In Vitro
H2O
Peptide Solubility and Storage Guidelines:
1. Calculate the length of the peptide.
2. Calculate the overall charge of the entire peptide according to the following table:
| Contents | Assign value | |
|---|---|---|
| Acidic amino acid | Asp (D), Glu (E), and the C-terminal -COOH. | -1 |
| Basic amino acid | Arg (R), Lys (K), His (H), and the N-terminal -NH2 | +1 |
| Neutral amino acid | Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) | 0 |
3. Recommended solution:
| Overall charge of peptide | Details |
|---|---|
| Negative (<0) |
1. Try to dissolve the peptide in water first. 2. If water fails, add NH4OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide. |
| Positive (>0) |
1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO. |
| Zero (=0) |
1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration. |
Purity & Documentation
-
Data Sheet (270 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Chen X, et al. The tarantula toxin psalmotoxin 1 inhibits acid-sensing ion channel (ASIC) 1a by increasing its apparent H+ affinity. J Gen Physiol. 2005 Jul;126(1):71-9. [Content Brief]
[2]. Claudia A McCarthy, et al. PcTx1 affords neuroprotection in a conscious model of stroke in hypertensive rats via selective inhibition of ASIC1a. Neuropharmacology. 2015 Dec;99:650-7. [Content Brief]
[3]. Niko Joeres, et al. Functional and pharmacological characterization of two different ASIC1a/2a heteromers reveals their sensitivity to the spider toxin PcTx1. Sci Rep. 2016 Jun 9;6:27647. doi: 10.1038/srep27647. [Content Brief]
[4]. Chao Yang, et al. Overexpression of acid-sensing ion channel 1a (ASIC1a) promotes breast cancer cell proliferation, migration and invasion. Transl Cancer Res. 2020 Dec;9(12):7519-7530. [Content Brief]
[5]. Feng Cai, et al. Acid-sensing ion channel 1a regulates the survival of nucleus pulposus cells in the acidic environment of degenerated intervertebral discs. Iran J Basic Med Sci. 2016 Aug;19(8):812-820. [Content Brief]
[6]. P Escoubas, et al. Isolation of a tarantula toxin specific for a class of proton-gated Na+ channels. J Biol Chem. 2000 Aug 18;275(33):25116-21. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Keywords
- Psalmotoxin 1
- 880107-52-8
- PcTx1
- Psalmopoeus cambridgei toxin-1
- Psalmotoxin1
- Psalmotoxin-1
- PcTx 1
- PcTx-1
- Psalmopoeus cambridgei toxin1
- Psalmopoeus cambridgei toxin 1
- Psalmopoeus cambridgei toxin-1
- Sodium Channel
- Apoptosis
- Spider toxin
- hypertensive
- neuroprotection
- breast cancer
- MDA-MB-231
- MCF-7
- NPCs
- apoptosis
- Inhibitor
- inhibitor
- inhibit