CDK7 Protein, Human (sf9, GST)

Together with its regulatory partners CCNH and MNAT1, CDK7 functions as an important serine/threonine kinase in cell cycle regulation and RNA polymerase II-mediated transcription. As the catalytic subunit of the CDK-activated kinase (CAK) complex, CDK7 plays a key role in activating CDK1/cyclin-B and CDK2/cyclin during cell cycle transitions. CDK7 Protein, Human (Sf9, GST) is the recombinant human-derived CDK7, expressed by Sf9 insect cells, with GST labeled tag. The total length of CDK7 Protein, Human (Sf9, GST) is 346 a.a..

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Together with its regulatory partners CCNH and MNAT1, CDK7 functions as an important serine/threonine kinase in cell cycle regulation and RNA polymerase II-mediated transcription. As the catalytic subunit of the CDK-activated kinase (CAK) complex, CDK7 plays a key role in activating CDK1/cyclin-B and CDK2/cyclin during cell cycle transitions. CDK7 Protein, Human (Sf9, GST) is the recombinant human-derived CDK7, expressed by Sf9 insect cells, with GST labeled tag. The total length of CDK7 Protein, Human (Sf9, GST) is 346 a.a..

Background

CDK7, in conjunction with its regulatory partners CCNH and MNAT1, functions as a serine/threonine kinase with pivotal roles in cell cycle regulation and RNA polymerase II-mediated transcription. As a catalytic subunit of the CDK-activating kinase (CAK) complex, CDK7 plays a critical role in the activation and formation of CDK1/cyclin-B during the G2-M transition and CDK2/cyclins during the G1-S transition. Its phosphorylation targets include SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6, and CDK11B/CDK11. Through threonine phosphorylation, CAK activates cyclin-associated kinases, thereby regulating cell cycle progression. Moreover, CDK7, when complexed with the core-TFIIH basal transcription factor, facilitates RNA polymerase II activation by serine phosphorylation of the C-terminal domain (CTD) of its large subunit (POLR2A). This activation enables RNA polymerase II to escape the promoter and initiate transcript elongation. CDK7's consistent expression and activity throughout the cell cycle contribute to its involvement in DNA-bound peptides-mediated transcription and cellular growth inhibition. Additionally, in response to DNA damage, CDK7 triggers the activation of p53/TP53, forming a feedback loop where p53/TP53 can subsequently inactivate CDK7, potentially leading to cell cycle arrest, transcriptional shutdown, and cellular recovery or apoptosis.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag GST
  • Accession
  • Gene ID
  • Protein Length

    Full Length

  • Synonyms

    CDK7; Cyclin-Dependent Kinase 7 (Homolog Of Xenopus MO15 Cdk-Activating Kinase); Cyclin Dependent Kinase 7; Homolog Of Xenopus MO15 Cdk-Activating Kinase; CDKN7; Serine/Threonine Protein Kinase MO15; CAK1; Cyclin-Dependent Kinase 7 Isoform 3; MO15; Serine

  • AA Sequence

    MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

  • Predicted Molecular Mass

    65.6 kDa

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00