1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins CMGC
  4. Cyclin-Dependent Kinases (CDKs) CDK
  5. Cyclin-Dependent Kinase 7 (CDK7)
  6. CDK7 Protein, Human (sf9, GST)

Together with its regulatory partners CCNH and MNAT1, CDK7 functions as an important serine/threonine kinase in cell cycle regulation and RNA polymerase II-mediated transcription. As the catalytic subunit of the CDK-activated kinase (CAK) complex, CDK7 plays a key role in activating CDK1/cyclin-B and CDK2/cyclin during cell cycle transitions. CDK7 Protein, Human (Sf9, GST) is the recombinant human-derived CDK7, expressed by Sf9 insect cells, with GST labeled tag. The total length of CDK7 Protein, Human (Sf9, GST) is 346 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Together with its regulatory partners CCNH and MNAT1, CDK7 functions as an important serine/threonine kinase in cell cycle regulation and RNA polymerase II-mediated transcription. As the catalytic subunit of the CDK-activated kinase (CAK) complex, CDK7 plays a key role in activating CDK1/cyclin-B and CDK2/cyclin during cell cycle transitions. CDK7 Protein, Human (Sf9, GST) is the recombinant human-derived CDK7, expressed by Sf9 insect cells, with GST labeled tag. The total length of CDK7 Protein, Human (Sf9, GST) is 346 a.a..

Background

CDK7, in conjunction with its regulatory partners CCNH and MNAT1, functions as a serine/threonine kinase with pivotal roles in cell cycle regulation and RNA polymerase II-mediated transcription. As a catalytic subunit of the CDK-activating kinase (CAK) complex, CDK7 plays a critical role in the activation and formation of CDK1/cyclin-B during the G2-M transition and CDK2/cyclins during the G1-S transition. Its phosphorylation targets include SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6, and CDK11B/CDK11. Through threonine phosphorylation, CAK activates cyclin-associated kinases, thereby regulating cell cycle progression. Moreover, CDK7, when complexed with the core-TFIIH basal transcription factor, facilitates RNA polymerase II activation by serine phosphorylation of the C-terminal domain (CTD) of its large subunit (POLR2A). This activation enables RNA polymerase II to escape the promoter and initiate transcript elongation. CDK7's consistent expression and activity throughout the cell cycle contribute to its involvement in DNA-bound peptides-mediated transcription and cellular growth inhibition. Additionally, in response to DNA damage, CDK7 triggers the activation of p53/TP53, forming a feedback loop where p53/TP53 can subsequently inactivate CDK7, potentially leading to cell cycle arrest, transcriptional shutdown, and cellular recovery or apoptosis.

Species

Human

Source

Sf9 insect cells

Tag

GST

Accession

P50613 (M1-F346)

Gene ID

1022

Protein Length

Full Length

Synonyms
CAK; CAK1; CDKN7; MO15; STK1
AA Sequence

MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Predicted Molecular Mass
65.6 kDa
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CDK7 Protein, Human (sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CDK7 Protein, Human (sf9, GST)
Cat. No.:
HY-P703556
Quantity:
MCE Japan Authorized Agent: