CDKN1B Protein, Human (His)
Based on 1 Customer Validation
The CDKN1B protein is a key cell cycle regulator that inhibits CDK2 when bound to cyclin A, thereby inhibiting G1 phase progression. It exhibits significant inhibitory effects on cyclin E- and cyclin A-CDK2 complexes. CDKN1B Protein, Human (His) is the recombinant human-derived CDKN1B protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CDKN1B protein is a key cell cycle regulator that inhibits CDK2 when bound to cyclin A, thereby inhibiting G1 phase progression. It exhibits significant inhibitory effects on cyclin E- and cyclin A-CDK2 complexes. CDKN1B Protein, Human (His) is the recombinant human-derived CDKN1B protein, expressed by E. coli , with N-6*His labeled tag.
Background
The CDKN1B protein serves as a pivotal regulator in cell cycle progression, exerting its influence through multifaceted interactions and activities. Acting as a potent inhibitor, CDKN1B restrains the kinase activity of CDK2 when bound to cyclin A, while exhibiting lesser inhibitory effects on CDK2 associated with SPDYA. This protein is intricately involved in G1 arrest and displays a pronounced inhibitory impact on cyclin E- and cyclin A-CDK2 complexes. Notably, it forms complexes with cyclin type D-CDK4, playing a crucial role in their assembly, stability, and modulation of CCND1-CDK4 complex activation. The phosphorylation state and stoichiometry of CDKN1B determine whether it functions as an inhibitor or activator of cyclin type D-CDK4 complexes. Additionally, CDKN1B engages in diverse interactions, including those with proteins such as CCNE1, COPS5, NUP50, 14-3-3, AKT1, LYN, CDK2, SPDYA, cyclin D, CDK4, GRB2, PIM1, SKP1, SKP2, CKS1B, UHMK1, and CDK1, highlighting its versatility in modulating cell cycle dynamics. Notably, its dephosphorylation on Thr-187 by PPM1H contributes to CDKN1B stability.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P46527 (M1-T198)
-
Molecular Construction
-
N-term
-
6*His
-
CDKN1B (M1-T198)
Accession # P46527 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CDKN1B; P27Kip1; Cyclin Dependent Kinase Inhibitor 1B; Truncated Cyclin-Dependent Kinase Inhibitor 1B; KIP1; MEN1B; Cyclin-Dependent Kinase Inhibitor 1B; CDKN4; P27KIP1; MEN4; Cyclin-Dependent Kinase Inhibitor 1B (P27, Kip1); P27; Cyclin-Dependent Kinase
-
AA Sequence
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
-
Predicted Molecular Mass
24.2 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)