Tozuleristide
Tozuleristide is a tumor-targeting agent covalently conjugated to a derivative of the near-infrared fluorescent dye indocyanine green (ICG). Tozuleristide has the ability to penetrate the blood-brain barrier. Tozuleristide can be used in research related to fluorescence-guided surgery (FGS).
For research use only. We do not sell to patients.
- CAS No.: 1673565-40-6
- Formula: C158H248N56O48S11
- Molecular Weight:4052.72
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | Plexxikon| | 2011-05 | PHASE1 |
Chemical Information
-
CAS No. 1673565-40-6
-
Molecular Weight 4052.72
-
Formula C158H248N56O48S11
-
Sequence
Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Arg-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Arg-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg (Disulfide bridge: Cys2-Cys19; Cys5-Cys28; Cys16-Cys33; Cys20-Cys35)
-
Sequence Shortening
MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCR (Disulfide bridge: Cys2-Cys19; Cys5-Cys28; Cys16-Cys33; Cys20-Cys35)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Tozuleristide Related Classifications
HY-P3196 Related Classifications
Powered by Bioz