country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5920

Copy Link Print Information

Urotoxin

(Synonyms: α-KTx 6.21)

Urotoxin is an inhibitor of the potassium channel. Urotoxin has a selective affinity for hKv1.2 channel.

For research use only. We do not sell to patients.

Formula: C₁₆₁H₂₆₀N₅₂O₅₀S₉
Molecular Weight:4012.69

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Urotoxin Chemical Structure

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

Urotoxin is an inhibitor of the potassium channel. Urotoxin has a selective affinity for hKv1.2 channel^[1].

Chemical Information

Molecular Weight 4012.69
Formula C₁₆₁H₂₆₀N₅₂O₅₀S₉
Synonyms

α-KTx 6.21
Sequence

Gly-Asp-Ile-Lys-Cys-Ser-Gly-Thr-Arg-Gln-Cys-Trp-Gly-Pro-Cys-Lys-Lys-Gln-Thr-Thr-Cys-Thr-Asn-Ser-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Gly-Cys-Val-NH2 (Disulfide bridge: Cys5-Cys26, Cys11-Cys31, Cys15-Cys33, Cys21-Cys36)
Sequence Shortening

GDIKCSGTRQCWGPCKKQTTCTNSKCMNGKCKCYGCV-NH2 (Disulfide bridge: Cys5-Cys26, Cys11-Cys31, Cys15-Cys33, Cys21-Cys36)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (258 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Karen Luna-Ramírez, et al. Structure, molecular modeling, and function of the novel potassium channel blocker urotoxin isolated from the venom of the Australian scorpion Urodacus yaschenkoi. Mol Pharmacol. 2014, 86, 1. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock