2. Peptides
  3. wt hMLN TFA

wt hMLN (TFA) is a microprotein that inhibits of SR Ca2+ pump (SERCA). wt hMLN plays an important role in skeletal muscle calcium homeostasis.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

wt hMLN TFA Chemical Structure

wt hMLN TFA Chemical Structure

Size Price Stock Quantity
1 mg USD 260 In-stock
5 mg   Get quote  
10 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of wt hMLN TFA:

wt hMLN TFA Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

wt hMLN (TFA) is a microprotein that inhibits of SR Ca2+ pump (SERCA). wt hMLN plays an important role in skeletal muscle calcium homeostasis[1].

Molecular Weight

5194.22 (free acid)

Formula

C245H404N54O66S..xC2HF3O2
Appearance

Solid

Color

White to off-white

Sequence

Met-Thr-Gly-Lys-Asn-Trp-Ile-Leu-Ile-Ser-Thr-Thr-Thr-Pro-Lys-Ser-Leu-Glu-Asp-Glu-Ile-Val-Gly-Arg-Leu-Leu-Lys-Ile-Leu-Phe-Val-Ile-Phe-Val-Asp-Leu-Ile-Ser-Ile-Ile-Tyr-Val-Val-Ile-Thr-Ser (TFA salt)
Sequence Shortening

MTGKNWILISTTTPKSLEDEIVGRLLKILFVIFVDLISIIYVVITS (TFA salt)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

wt hMLNOthersSERCAmicroproteinskeletal muscle calcium homeostasisInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
wt hMLN TFA
Cat. No.:
HY-P6013A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.