wt hMLN TFA
Based on 1 Customer Validation
wt hMLN (TFA) is a microprotein that inhibits of SR Ca2+ pump (SERCA). wt hMLN plays an important role in skeletal muscle calcium homeostasis.
For research use only. We do not sell to patients.
- Purity : 95.0%
- Formula: C245H404N54O66S..xC2HF3O2
- Molecular Weight:5194.22 (free acid)
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Protocols
- Purity & Documentation
- References
-
Help & FAQs
All Calcium Channel Isoforms
More
Biological Activity
Description
Chemical Information
-
Appearance Solid
-
Molecular Weight 5194.22 (free acid)
-
Formula C245H404N54O66S..xC2HF3O2
-
Color White to off-white
-
Sequence
Met-Thr-Gly-Lys-Asn-Trp-Ile-Leu-Ile-Ser-Thr-Thr-Thr-Pro-Lys-Ser-Leu-Glu-Asp-Glu-Ile-Val-Gly-Arg-Leu-Leu-Lys-Ile-Leu-Phe-Val-Ile-Phe-Val-Asp-Leu-Ile-Ser-Ile-Ile-Tyr-Val-Val-Ile-Thr-Ser (TFA salt)
-
Sequence Shortening
MTGKNWILISTTTPKSLEDEIVGRLLKILFVIFVDLISIIYVVITS (TFA salt)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Protocols
-
Ca2+ Staining Technique
Ca2+ staining is an experimental technique that utilizes specific fluorescent probes (such as Fluo-4 AM, Fura-2, etc.) to qualitatively or quantitatively detect dynamic changes in intracellular Ca2+ concentrations; this is achieved by monitoring the changes in fluorescent signals generated when these probes bind to free intracellular calcium ions. The underlying principle relies primarily on the presence of chelating groups within the probe's molecular structure that possess high affinity for calcium ions.
Purity & Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
wt hMLN TFA Related Classifications
HY-P6013A Related Classifications
Powered by Bioz