CCR
CC chemokine receptor
CCR Isoform Specific Products
All Product Categories
-
CCR Inhibitors
(106)
View all products
-
CCR Agonists
(7)
View all products
-
CCR Antagonists
(148)
View all products
-
CCR Activators
(5)
View all products
-
CCR Modulators
(2)
View all products
-
CCR Chemical
(1)
View all products
-
CCR Degraders
(2)
View all products
-
CCR Controls
(2)
View all products
-
CCR Ligands
(4)
View all products
-
CC Chemokines Proteins
(144)
View all products
-
CCR1 Proteins
(2)
View all products
-
CCR4 Proteins
(2)
View all products
-
CCR5 Proteins
(5)
View all products
-
CCR6 Proteins
(1)
View all products
-
CCR7 Proteins
(1)
View all products
-
CCR8 Proteins
(4)
View all products
-
CCR9 Proteins
(2)
View all products
-
CCR2/CD192 Proteins
(3)
View all products
-
CCR Related Products (302)
Related Products (302)
-
Recombinant Proteins (164)
-
Antibodies (12)
-
CCR Isoform Comparison
-
Azirkitug
0 ImagesSynonyms: PR-1925514 -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Flt-3L-Ig (hum/hum)
0 ImagesCat. No.: HY-P991208Purity: 98%Synonyms: human Flt3L; hFlt3LFlt-3L-Ig (hum/hum) (hFlt3L) is a Flt3 ligand. Flt-3L-Ig (hum/hum) enhances the release of inflammatory cytokines from myeloid cells and dendritic cells in BRGSF-CBC mice induced by OKT3. Flt-3L-Ig (hum/hum) increases the release of IL-2, CCL2 and CXCL10 in an OKT3-dependent manner. Flt-3L-Ig (hum/hum) can be used in studies related to cytokine release syndrome. Flt-3L-Ig (hum/hum) can be used in studies related to psoriasis-like skin inflammation. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
GSK-3050002
0 ImagesCat. No.: HY-P990592Synonyms: E-6071; HGS-1035GSK-3050002 (E-6071) is a CHO-expressed humanized antibody that targets CCL20. GSK-3050002 (E-6071) features a huIgG1 heavy chain and a huκ light chain, with a predicted molecular weight (MW) of 150 kDa. The isotype control for GSK-3050002 (E-6071) can refer to Human IgG1 kappa, Isotype Control (HY-P99001). -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Globulol
0 ImagesGlobulol is a terpenoid metabolite and Antimicrobial agent. Globulol can be isolated from Alpinia oxyphylla Miq. Globulol binds to PAK4, reduces the expression level of PAK4 in cancer cells, decreases the phosphorylation of AKT, and downregulates the expressions of STAT3, phosphorylated STAT3, and PD-L1. Globulol promotes the secretion of CCL4 by cancer cells. Globulol reduces the viability and proliferation ability of cancer cells, induces G0/G1 cell cycle arrest and Apoptosis in cancer cells, and inhibits cancer cell migration and the integrity of 3D tumor spheres. Globulol enhances the relevant effects of anti-PD-1 agents in the cancer cell microenvironment. Globulol exhibits anticancer activity against liver cancer. Globulol inhibits the mycelial growth of phytopathogenic fungi and the growth of phytopathogenic bacteria. Globulol can be used in studies related to hepatocellular carcinoma. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- CCR4-351 hydrochloride
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
PF-04634817
0 ImagesCat. No.: HY-117621CAS No.: 1228111-63-4 -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
AZD-5672
0 ImagesCat. No.: HY-119101CAS No.: 780750-65-4AZD-5672 is an orally active, potent, and selective CCR5 antagonist (IC50=0.32 nM). AZD-5672 shows moderate activity against the hERG ion channel (binding IC50=7.3 μM). AZD5672 is a substrate of human P-gp, and inhibits P-gp-mediated digoxin transport (IC50=32 μM). AZD-5672 can be used for the research of rheumatoid arthritis. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Met-RANTES (human)
0 ImagesCat. No.: HY-P4191CAS No.: 1883816-50-9Synonyms: MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
INCB3344 R-isomer
0 ImagesCat. No.: HY-50674APurity: 98.01%INCB3344 R-isomer is the R-isomer of INCB3344. INCB3344 is a potent, selective and orally bioavailable CCR2 antagonist with IC50 values of 5.1 nM (hCCR2) and 9.5 nM (mCCR2) in binding antagonism and 3.8 nM (hCCR2) and 7.8 nM (mCCR2) in antagonism of chemotaxis activity. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
(1S)-CCR2 antagonist 1
0 Images(1S)-CCR2 antagonist 1 is a left-handed chiral body of CCR2 antagonist 1 (HY-112792). CCR2 antagonist 1 is a high-affinity and long-residence-time CCR2 antagonist, with a Ki of 2.4 nM. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Calamenene
0 ImagesCat. No.: HY-N10116ACAS No.: 483-77-2Calamenene is a sesquiterpene compound. Calamenene promotes dendritic cell maturation, upregulates CD1a, CD80, CD83, CD86, HLA-DR and CCR7 on the cell surface, reduces endocytic activity, enhances T cell-stimulating capacity, drives Th1 polarization through the secretion of IL-12, induces IFN-γ production, decreases IL-4 generation, and triggers intracellular Ca2+ mobilization as well as dendritic cell migration towards MIP-3β. Calamenene exerts bacteriostatic and bactericidal growth-inhibitory effects against pathogenic *Vibrio harveyi*. Calamenene can be used in studies related to cancer and bacterial infections. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Resolvin D5
0 ImagesResolvin D5 is an anti-inflammatory and analgesic agent produced in M2 macrophages. Resolvin D5 alleviates Paclitaxel (HY-B0015)-induced mechanical allodynia and inflammatory pain by activating the GPR32 receptor, with gender specificity (effective only in male mice) and independence from TRPV1 or TRPA1 channels. Resolvin D5 attenuates LPS-induced ERK phosphorylation and NF-κB nuclear translocation, downregulates proinflammatory mediators such as IL-6 and CCL5, inhibits Th17 cell differentiation and osteoclastogenesis, promotes regulatory T cell differentiation, and shows no cytotoxicity to human monocytes. The level of Resolvin D5 is elevated in arthritic SKG mice, but Resolvin D5 has no effect on dendritic cell differentiation or M1 macrophage polarization, nor does it prevent ZyA-induced arthritis progression. Resolvin D5 is suitable for research related to chemotherapy-induced peripheral neuropathy, inflammatory pain and rheumatoid arthritis. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
ECL1i TFA
0 ImagesCat. No.: HY-P11553AECL1i TFA is an allosteric, selective CCR2 inhibitor. ECL1i TFA specifically inhibits CCL2-/CCR2-mediated chemotaxis. ECL1i TFA interferes with CCR2-positive cell recruitment and attenuates disease progression in experimental autoimmune encephalomyelitis. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- Aplaviroc
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
S-531011 (FUT8-KO)
0 ImagesCat. No.: HY-P991481AS-531011 (FUT8-KO) is an anti-CCR8 monoclonal antibody expressed by CHO cells with the fucosyltransferase 8 gene (FUT8) knocked out. Fucose deficiency enhances the antibody-dependent cellular cytotoxicity (ADCC) effect of the antibody. S-531011 (FUT8-KO) can be used for the research of cancer immunity. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
(S)-IDOR-1117-2520
0 ImagesCat. No.: HY-162495APurity: 99.47%(S)-IDOR-1117-2520 is the S-isomer of IDOR-1117-2520 (HY-162495). IDOR-1117-2520 is an orally active, potent, selective and reversible CCR6 antagonist. IDOR-1117-2520 antagonizes the CCL20-mediated calcium flow (IC50 = 63 nM) and inhibits β-arrestin recruitment to human CCR6 (IC50 = 30 nM) in cells expressing recombinant human CCR6. IDOR-1117-2520 is found to be a substrate of P-gp/MDR1. IDOR-1117-2520 can be used in the research of autoimmune diseases and skin inflammation. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
CCR4 antagonist 3
0 ImagesCCR4 antagonist 3 is a potent chemokine receptor 4 (CCR4) antagonist with an IC50 value of 1.7 μM for [125I]TARC (thymus and activation regulated chemokine). CCR4 antagonist 3 inhibits binding of radiolabeled TARC and macrophage-derived chemokine (MDC) to CCR4 receptors on the surface of CEM cells. CCR4 antagonist 3 also inhibits the in vitro migration of CEM cells mediated by TARC (IC50 = 6.4 μM). -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
CCR6 Human Pre-designed siRNA Set A
0 ImagesCat. No.: HY-RS02163 -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- Minokitug
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
DOTA-ECL1i
0 ImagesDOTA-ECL1i is a conjugate of the CCR2 inhibitor ECL1i (HY-P11553) and DOTA. When radiolabeled with 68Ga, DOTA-ECL1i serves as a PET tracer that targets CCR2 expression. DOTA-ECL1i can be used in research related to pulmonary fibrosis, cardiac injury, abdominal aortic aneurysm inflammation, atherosclerosis, head and neck cancer, and pancreatic cancer. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
No matching results
No matching results
No matching results
No matching results
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
Your Search Returned No Results.
Sorry. There is currently no product that acts on isoform Bcl-2, Bcl-W and Bim together.Please
try each isoform separately.