(Pro3) GIP, human
(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 299898-52-5
- Formel: C226H338N60O64S
- Molecular Weight:4951.53
-
Speicherung:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
- Reinheit & Dokumentation
- Verweise
-
Help & FAQs
Biologische Aktivität
EC50: 0.026 nM (hGIPR)[2]
Ki/Kd: 0.90 nM (hGIPR); 1.1 nM (Rat GIPR); 0.72 nM (Mouse GIPR)[2]
(Pro3) GIP, human induces cAMP accumulation with an EC50 value of 0.026 nM[2].
(Pro3) GIP, human has high binding affinity for human GIPR, Rat GIPR and Mouse GIPR with Ki/ Kd values of 0.90 nM, 1.1 nM and 0.72 nM, respectively[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS. Nr. 299898-52-5
-
Appearance Solid
-
Molecular Weight 4951.53
-
Formel C226H338N60O64S
-
Color White to off-white
-
Synonyms
(Pro3) Gastric Inhibitory Peptide, human
-
Sequence
Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
-
Sequence Shortening
YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Reinheit & Dokumentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Victor A Gault, et al. Chemical ablation of gastric inhibitory polypeptide receptor action by daily (Pro3)GIP administration improves glucose tolerance and ameliorates insulin resistance and abnormalities of islet structure in obesity-related diabetes. Diabetes. 2005 Aug;54(8):2436-46. [Content Brief]
[2]. A H Sparre-Ulrich, et al. Species-specific action of (Pro3)GIP - a full agonist at human GIP receptors, but a partial agonist and competitive antagonist at rat and mouse GIP receptors. Br J Pharmacol. 2016 Jan;173(1):27-38. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
(Pro3) GIP, human Related Classifications
HY-P3584 Related Classifications
Powered by Bioz