country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P10622

Copy Link Print Information

SHLP-3

SHLP-3 is a mitochondrial derived peptide encoded by the 16S ribosomal RNA (MT-RNR2) gene. SHLP-3 increases cell viability and reduces apoptosis in insulinoma NIT-1β cells and human prostate cancer 22Rv1 cells. SHLP-3 increases mitochondrial function and exerts cytoprotective effects by increasing mitochondrial oxygen consumption rate (OCR), cellular ATP and reducing the ability to produce ROS. SHLP-3 can be used in the study of diabetes and cancer.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Formule: C₂₁₄H₃₀₁N₄₇O₄₉S₂
Masse moléculaire:4380.10

Stockage:

Please store the product under the recommended conditions in the Certificate of Analysis.

SHLP-3 Chemical Structure

Size

Prix

Stock

Quantité

Amount: USD 0.00

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Activité biologique

Description

Chemical Information

Masse moléculaire 4380.10
Formule C₂₁₄H₃₀₁N₄₇O₄₉S₂
Sequence

Met-Leu-Gly-Tyr-Asn-Phe-Ser-Ser-Phe-Pro-Cys-Gly-Thr-Ile-Ser-Ile-Ala-Pro-Gly-Phe-Asn-Phe-Tyr-Arg-Leu-Tyr-Phe-Ile-Trp-Val-Asn-Gly-Leu-Ala-Lys-Val-Val-Trp
Sequence Shortening

MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW
Livraison

Room temperature in continental US; may vary elsewhere.
Stockage

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureté et documentation

Select Batch:

Pureté: 99.98%

Assay: 99.98%

ee.: 99.98%

Fiche technique (258 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instruction de manipulation (2659 KB)

Références

[1]. Satadeepa Kal, et al. "Mitochondrial-derived peptides: Antidiabetic functions and evolutionary perspectives." Peptides (2023): 171147. [Content Brief]

Calculators

Calculateur de molarité

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculateur de dilution

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Obtenir un devis En stock