IL-1 beta Protein, Rat
Based on 23 publication(s) in Google Scholar
IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions. IL-1 beta Protein, Rat is expressed in E. coli.
- Species: Rat
- Source: E. coli
-
Speicherung:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biologische Aktivität
IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Rat is expressed in E. coli.
Interleukin-1β (IL-1β) is one of the pro-inflammatory cytokines and is produced and secreted by a variety of cell types although the vast majority of studies have focussed on its production within cells of the innate immune system, such as monocytes and macrophages[1][2].
IL-1β is produced as inactive pro-IL-1β (encoded by pro-Il-1b) in response to inflammatory stimuli, including both microbial products and endogenous danger-associated molecules. IL-1β gene expression and synthesis of pro-IL-1β occurs after activation of pattern recognition receptors (PRRs). Inflammatory stimuli also drive activation of cytosolic CARD and PYHIN domain-containing PRRs that recruit ASC and caspase-1 (Casp-1) to assemble into the multiprotein complex inflammasome. Pro-Casp-1 (encoded by pro-Casp-1), activated by the inflammasome, cleaves pro-IL-1β into the bioactive IL-1β. IL-1β acts in an autocrine/paracrine manner via the type I IL-1 receptor (IL-1R1)[1][2][3].
IL-1β could regulate the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. IL-1β also plays a significant regulator of reproduction in females[1][2][3].
IL-1β (1-15625 pg/mL; 12 hours) dose-dependently increases production of the NF-κB-dependent inflammatory cytokine TNF-α, and a significant effect of IL-1β is observed at concentrations as low as 5 pg/mL in immortalized murine RAW264.7 macrophages[1].
IL-1β (1, 10 and 100 ng/mL; 24 hours) results in a dose-dependent increase of cell proliferation in pig heart cells. IL-1β increases the gene expression of caspase-3, and increases the enzymatic activities of MMP-2 and MMP-9[2].
IL-1β (8 ng; i.p.; daily; for 3 days) rescues Casp1−/− mice, restores survival and reduces lung bacterial load (i.e. days 0, 1, and 2 post-infection) in Chlamydia pneumoniae infected Casp1−/− mice. Yet, mice treated later (days 2, 3 and 4 post-infection) shows significantly increased bacterial counts relative to early-treated mice[3].
1.The ED50 is <10 pg/mL as measured by mouse D10S cells, corresponding to a specific activity of >1.0 × 108 units/mg.
2.Measured in a cell proliferation assay using CTLL-2 mouse T lymphocyte. The ED50 for this effect is 7.721 ng/mL, corresponding to a specific activity is 1.30×105 U/mg.
3.Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is 0.1959 μg/mL.
4. Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is <10 pg/mL.
Publications (23)
-
Journal Impact Factor
-
Most Recent
-
Biomaterials
CytoplastCXCR4: An enucleated self-eliminating and mitochondria delivering strategy for targeted cartilage defect therapy. [Abstract]2026 Sep:332:124167. PMID: 41905215 -
Nat Cardiovasc Res
The drug-elicitable alternative splicing module for tunable vector expression in the heart. [Abstract]2025 Jul;4(7):938-955. PMID: 40514436 -
-
Small
Vertex-Integrated Tetrahedral DNA Nanoframe Enhances miR-143-3p Delivery for Osteoarthritis Therapy. [Abstract]2026 Mar 11:e11570. PMID: 41808575 -
Acta Pharmacol Sin
The caspase-1 inhibitor VX765 upregulates connexin 43 expression and improves cell-cell communication after myocardial infarction via suppressing the IL-1β/p38 MAPK pathway. [Abstract]2022 Sep;43(9):2289-2301. PMID: 35132192
IL-1 beta Protein, Rat purchased from MedChemExpress. Usage Cited in: Acta Pharmacol Sin. 2022 Sep;43(9):2289-2301. [Abstract]
Western blotting was used to detect alterations in the protein expression of p38 MAPK and Cx43 in RCMs stimulated with supernatant from rat cardiac fibroblasts (RCFs). Exogenous IL-1β (80 ng/mL) was used to stimulate RCMs for 24 h and was used in combination with the IL-1β inhibitor TLR1 (40 μM) or p-38 MAPK inhibitor SB203580 (3 μM).
IL-1 beta Protein, Rat purchased from MedChemExpress. Usage Cited in: Acta Pharmacol Sin. 2022 Sep;43(9):2289-2301. [Abstract]
Immunostaining for total Cx43 and counterstaining with DAPI to visualize nuclei (40 ×). Bars = 25 μm. The results showed that SB203580 and TLR1 both alleviated the internalization of Cx43 induced by IL-1β (80 ng/mL; 24 h).
-
J Transl Med
Pulsed electromagnetic fields potentiate bone marrow mesenchymal stem cell chondrogenesis by regulating the Wnt/β-catenin signaling pathway. [Abstract]2024 Aug 6;22(1):741. PMID: 39107784 -
Int J Mol Med
DUSP26: Unveiling a critical molecular mediator and therapeutic target in developmental dysplasia of the hip‑associated secondary osteoarthritis. [Abstract]2026 Apr;57(4):105. PMID: 41789628 -
J Pineal Res
Melatonin Improves Diabetic-Accelerated Experimental Osteoarthritis by Inhibiting NLRP3-Mediated Chondrocyte Pyroptosis via PKG/Nrf2. [Abstract]2026 Mar;78(2):e70113. PMID: 41704066 -
J Agric Food Chem
Ginsenoside Compound K Ameliorates Osteoarthritis by Inhibiting the Chondrocyte Endoplasmic Reticulum Stress-Mediated IRE1α-TXNIP-NLRP3 Axis and Pyroptosis. [Abstract]2023 Jan 25;71(3):1499-1509. PMID: 36630614
IL-1 beta Protein, Rat purchased from MedChemExpress. Usage Cited in: J Agric Food Chem. 2023 Jan 25;71(3):1499-1509. [Abstract]
IL-1β (10 ng/mL; 24 h). TXNIP, XBP1, and IRE1α protein expression was determined using western blotting.
-
Eur J Pharmacol
Dihydromyricetin attenuates intervertebral disc degeneration by inhibiting NLRP3 inflammasome activation via the Keap1/Nrf2/HO-1 pathway. [Abstract]2025 Jul 5:998:177501. PMID: 40058758 -
Eur J Pharmacol
GSK-3β-mediated activation of NLRP3 inflammasome leads to pyroptosis and apoptosis of rat cardiomyocytes and fibroblasts. [Abstract]2022 Apr 5;920:174830. PMID: 35182545
IL-1 beta Protein, Rat purchased from MedChemExpress. Usage Cited in: Eur J Pharmacol. 2022 Apr 5;920:174830. [Abstract]
Bcl-2, Bax, caspase-3, NLRP3, p-GSK-3β, and GSK-3β expression assessed using western blotting. RCMs were exposed to IL-1β (40 ng/mL, 24 h) with or without SB216763 (10 μM, pretreatment for 1 h) or TLR1 (40 μM, pretreatment for 1 h).
-
Int Immunopharmacol
Isorhapontigenin delays senescence and matrix degradation of nucleus pulposus cells via PI3K/AKT/mTOR-mediated autophagy pathway in vitro and alleviates intervertebral disc degeneration in vivo. [Abstract]2024 Sep 30:139:112717. PMID: 39067404 -
Bone Joint Res
Identification and validation of transcriptome-wide association study-derived genes as potential druggable targets for osteoarthritis. [Abstract]2025 Mar 13;14(3):224-235. PMID: 40079200
IL-1 beta Protein, Rat purchased from MedChemExpress. Usage Cited in: Bone Joint Res. 2025 Mar 13;14(3):224-235. [Abstract]
Representative immunofluorescence images and quantification of COL2 expression. Scale bar = 20 μm. Immunofluorescence staining revealed abundant punctate fluorescent aggregates in the IL-1β (20 ng/mL; 24 h)-stimulated group, indicating inflammasome formation, whereas the DHM-treated group presented significantly weakened and diffuse fluorescent signals.
-
Mediators Inflamm
Galanin Protects Rat Cortical Astrocyte from Oxidative Stress: Involvement of GalR2 and pERK1/2 Signal Pathway. [Abstract]2019 May 22:2019:2716028. PMID: 31249471 -
Regen Ther
Hypoxia-preconditioned bone marrow mesenchymal stem cell-derived exosomes ameliorate knee osteoarthritis by promoting cartilage regeneration and alleviating pain in rats. [Abstract]2025 Nov 30:31:101049. PMID: 41431477 -
J Orthop Surg Res
Obacunone acts as a histone deacetylase 1 inhibitor to limit p38MAPK signaling and alleviate osteoarthritis progression. [Abstract]2025 May 3;20(1):441. PMID: 40319261 -
J Bioenerg Biomembr
Chondroprotective effects of bone marrow mesenchymal stem cell-derived exosomes in osteoarthritis. [Abstract]2024 Feb;56(1):31-44. PMID: 38012335 -
J Biomater Sci Polym Ed
Neutrophil membrane-coated multifunctional biomimetic nanoparticles for spinal cord injuries. [Abstract]2024 Sep 19:1-25. PMID: 39298153 -
Kaohsiung J Med Sci
Melatonin Exerts Chondroprotective Effects Against Osteoarthritis by Promoting PI3K/AKT/FoxO3-Mediated Mitophagy. [Abstract]2025 Nov 5:e70131. PMID: 41190713 -
Orthop Surg
Proline-Serine-Threonine Phosphatase-Interacting Protein 2 Alleviates Diabetes Mellitus-Osteoarthritis in Rats through Attenuating Synovial Inflammation and Cartilage Injury. [Abstract]2021 Jun;13(4):1398-1407. PMID: 33939302 -
-
-
Aging (Albany NY)
α-Cyperone (CYP) down-regulates NF-κB and MAPKs signaling, attenuating inflammation and extracellular matrix degradation in chondrocytes, to ameliorate osteoarthritis in mice. [Abstract]2021 Jul 8;13(13):17690-17706. PMID: 34237707
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
Q63264 (V117-S268)
-
Molecular Construction
-
N-term
-
IL-1 beta (V117-S268)
Accession # Q63264 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL1B; IL-1B; Interleukin 1 Beta; Multifunctional Fusion Protein; IL1F2; Pro-Interleukin-1-Beta; Interleukin-1 Beta; Preinterleukin 1 Beta; IL1-BETA; Interleukin 1beta; IL-1 Beta; IL1beta; Catabolin; IL-1
-
AA Sequence
VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Reinheit
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122(10):3476-89. [Content Brief]
[2]. Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399(4):542-7. [Content Brief]
[3]. Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6(6):e21477. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)